KEGG   Tistrella mobilis: TMO_1503Help
Entry
TMO_1503          CDS       T02128                                 

Gene name
adhA
Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tmo  Tistrella mobilis
Pathway
tmo00010  Glycolysis / Gluconeogenesis
tmo00071  Fatty acid degradation
tmo00350  Tyrosine metabolism
tmo00625  Chloroalkane and chloroalkene degradation
tmo00626  Naphthalene degradation
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_1503 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    TMO_1503 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    TMO_1503 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TMO_1503 (adhA)
   00626 Naphthalene degradation
    TMO_1503 (adhA)
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TMO_1503 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 POR
Motif
Other DBs
NCBI-ProteinID: AFK53342
UniProt: I3TKQ4
Position
1669071..1670054
Genome map
AA seq 327 aa AA seqDB search
MKAMVLQRPGTALVMETRPDPEPGPGQILVRVLACAVCRTDLHVVDGDLPDPKLPVVPGH
EVVGVVEALGAGVDPSLAGRRVGVPWLGHACGTCRYCGMRAENLCDFPEFTGYTRDGGFA
THMLADAGFAFPLADDLDPVATAPLMCAGLIGWRSLKMAGEADRIGLYGFGAAAHIIAQV
CRWQGREVFAFTSPGDSAAQAHARALGAAWAGGSDQTPPAELDAAILFAPVGHLVPKALA
AVRKGGIVVCGGIHMSDIPSFPYSLLWGERRLVSVANLTRADGHEFLELAPRAGVKTSTT
IYPLADANRALDDLRHGRFQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgatggttctgcagcggccgggaacggcgctggtcatggagacgcggcctgat
cccgaaccgggccccgggcagatcctggtccgggtgctggcctgcgcggtctgccgcacc
gatctgcacgtggtcgatggcgatctgccggacccgaagctgccggtggtgccggggcat
gaagtggtgggtgtggtcgaggcgctgggcgccggcgtcgacccgtcgcttgccgggcgg
cgggtgggggtgccctggctggggcatgcctgtggtacctgccgctattgcggcatgcgg
gccgagaacctgtgcgatttccccgaattcaccggctacacccgcgatggcggcttcgcg
acccacatgctggccgatgccggtttcgcctttccgctggccgatgatctggacccggtg
gcgacggcgccgctgatgtgtgccgggttgatcggctggcgctcgctcaaaatggcgggg
gaggcggaccggatcgggctctatggcttcggcgccgccgcccatatcatcgcccaggtc
tgccgctggcaggggcgggaggtctttgcctttaccagcccgggcgacagcgcggcgcag
gctcatgcccgggccctgggcgcggcctgggccggcggctcggatcagacgccgccggcg
gagctggatgcggcgatcctgttcgcgccggtcggccatctggtgccgaaggcgctggcg
gcggtgcgcaagggcggcatcgtggtctgcggcggcatccatatgagcgacatcccgtcc
ttcccctacagcctgctctggggcgaacgccggctggtgtcggtcgccaatctcacccgt
gccgatggtcatgaattcctggagctggcgccgcgggccggcgtgaagacgtcgacgacc
atctacccgctggccgatgccaaccgcgcgctcgacgatctgcgccacggccggtttcag
ggggcggccgtgctcgtgccctga

DBGET integrated database retrieval system