KEGG   Tistrella mobilis: TMO_1589Help
Entry
TMO_1589          CDS       T02128                                 

Gene name
folK
Definition
7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tmo  Tistrella mobilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TMO_1589 (folK)
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TMO_1589 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1765659..1766156
Genome map
AA seq 165 aa AA seqDB search
MGFDVIGVSRWYESPPLPDNGGPWYVNGVVHAETVLEPVEALERLHAIEAAFGRVRRQRW
ESRPLDLDIIDHGGVVRRPRIAPVPIVPGAPVQTRGGAPDPELPHPRLHERAFVLLPLAD
VAPGWRHPTLDRSVEELIAALPAGQIIRPCMEEAPDSGGEALTSA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgatgtgatcggcgtgtcgcgctggtacgagagtccgccgctgccggacaat
ggcggaccgtggtatgtaaacggtgtcgtgcatgccgaaacggtgcttgagccggtcgag
gccctggagcggttgcatgcgatcgaagcggcattcggcagggtgcgtcgccagcgttgg
gagtcgcggccgctggatctggatattatagaccatggcggcgtggtccgtcgccctcgg
atcgcgccggtgcccatcgtgccgggcgccccggttcagaccaggggcggagcgccggac
ccggaactgccgcatccacggctgcatgaacgcgccttcgttctgctgccgcttgccgat
gtggcgccgggctggcgtcatccgaccctggaccgatcggtggaagagttgattgccgcg
ttgcctgcagggcagatcatccgtccctgcatggaggaagccccggattccggcggcgag
gctttgacttccgcatag

DBGET integrated database retrieval system