KEGG   Tistrella mobilis: TMO_1715Help
Entry
TMO_1715          CDS       T02128                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tmo  Tistrella mobilis
Pathway
tmo00010  Glycolysis / Gluconeogenesis
tmo00020  Citrate cycle (TCA cycle)
tmo00620  Pyruvate metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
Module
tmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_1715
   00020 Citrate cycle (TCA cycle)
    TMO_1715
   00620 Pyruvate metabolism
    TMO_1715
Enzymes [BR:tmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TMO_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFK53554
UniProt: I3TLB6
Position
complement(1896852..1898249)
Genome map
AA seq 465 aa AA seqDB search
MAQTILMPALSPTMTEGTLAKWLVSAGDKIESGQVIAEIETDKATMEVEAVDEGVLAEIL
VPEGTENVAVNTPIAVLKEEGDDDAAVAEAAAGAGAPAPAAKAEEAEAEGDDAGEAEVAA
APAPKASAKPAADGEGGRIKASPLARRIASEAGLDLSGVEGTGPHGRIVKADVEAAIASG
AKPAEAPKAPGRSDAAPAAEAPKATPAPAQQTGGGYSVAAISAAASAQTRDLVDKLGMPY
EAEANNGMRKTIARRLLDAKQTVPHFYLTVDCVIDRLLAVRKELNERAGDGVKISVNDFV
VRASALSLRKVPAANAAWTDEAVLRFKDVDVSVAVAIDGGLITPIIRKADTKGLAAISSE
MRDLATRARDGKLKPEEYQGGTFSVSNLGMYGIREFSAIINPPQSAILAAGAAEQRPVVK
DGALAIATVMTVTLSCDHRVVDGAVGAQFLAAFKKLIEDPLSMLL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccatcctgatgccggccctgtcgccgaccatgaccgaaggcacgctcgcc
aagtggctggtgtcggccggcgacaagatcgaaagcggacaggtgatcgccgaaatcgag
accgacaaggccaccatggaggtggaagcggtcgacgaaggcgtgctggcggagatcctg
gtgccggaaggcaccgagaatgtggccgtgaacacgccgatcgccgtgctcaaggaagag
ggcgacgacgatgcagcagtggcggaagctgccgccggtgccggcgcgcctgcgcccgcc
gccaaggcggaagaggccgaggccgaaggtgacgatgcgggtgaggcggaagtagcagca
gcacccgctcccaaggcgtcggcgaagccggcggccgatggcgagggcggccggatcaag
gcgagcccgctcgcccgccgcatcgcgtcggaggcgggacttgacctctccggtgttgag
ggcaccggtccgcatggccggatcgtgaaggccgatgtcgaggcggcgatcgcatcgggt
gcaaagccggccgaggcgccgaaagccccgggccgcagcgacgctgctccggccgccgag
gcgcccaaggcgaccccggcgccggcccagcagaccggtggcggctacagcgtggcggcg
atctcggccgcggcttctgcccagacccgcgatctggtcgacaagctgggcatgccgtat
gaggccgaggccaataacggcatgcgcaagaccatcgcccgccgcctgctcgacgccaag
cagaccgtgccgcatttctacctgacggtggactgcgtcatcgaccggctgctggcggtg
cgcaaggagctgaacgagcgtgccggcgacggcgtgaagatcagcgtcaatgatttcgtg
gtgcgggccagcgccctgtcgctgcgcaaggtgccggcggccaatgcggcctggaccgac
gaggcggtgctgcgcttcaaggatgtcgacgtctcggtggccgttgcgatcgacggcggg
ctgatcaccccgatcatccgcaaggccgataccaagggtctggccgcgatctcgtccgag
atgcgcgacctcgccacccgtgcccgcgacggcaagctgaagcccgaggagtatcagggc
gggaccttctcggtctctaacctcggcatgtacgggatcagggagttctcggcgatcatc
aacccgccgcagtcggcgatcctggccgccggtgccgccgagcagcggccggtggtgaag
gatggtgcgctggcgatcgcgacggtgatgacggttacactctcctgcgaccaccgggtg
gtggacggcgccgtcggcgcccagttcctggccgccttcaagaagctgatcgaggacccg
ctgtcgatgctgctctga

DBGET integrated database retrieval system