KEGG   Tistrella mobilis: TMO_1750Help
Entry
TMO_1750          CDS       T02128                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmo  Tistrella mobilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TMO_1750 (tpiA)
   01230 Biosynthesis of amino acids
    TMO_1750 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_1750 (tpiA)
   00051 Fructose and mannose metabolism
    TMO_1750 (tpiA)
   00562 Inositol phosphate metabolism
    TMO_1750 (tpiA)
Enzymes [BR:tmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TMO_1750 (tpiA)
Exosome [BR:tmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TMO_1750 (tpiA)
  Exosomal proteins of bladder cancer cells
   TMO_1750 (tpiA)
  Exosomal proteins of melanoma cells
   TMO_1750 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1934356..1935114)
Genome map
AA seq 252 aa AA seqDB search
MPHRPTPLVAGNWKMNMLVADGRALAAEVAAGAEGLAAGFAVCPPAALLPVVGEAIRGSK
VALGAQDCHAKASGAHTGDHAAALLKDVGCTYVIVGHSERRQDHGETDAVVAAKAEAAAA
AGLVPIVCVGETLDQYKAGEGVAVVETQVDGSVPASASADRLVVAYEPVWAIGSGLVPTT
DDIRAVHGAIRARLAARFGDAAQGIRILYGGSVKPGNAAEILGVDDVDGALVGGASLNAA
DFLAIGAAAPAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatcgtcccacgccgctggtcgccgggaactggaagatgaacatgctggtggcc
gatggccgcgcgcttgcggccgaagtcgccgccggcgccgaaggcctcgccgccgggttt
gccgtctgcccgcccgccgcactgcttccggtcgtgggcgaggcgatccgcggttcgaag
gtcgccctgggcgcccaggactgccacgccaaggcctccggtgcccacaccggtgatcat
gccgccgccctgctcaaggatgtcggctgcacctatgtgatcgtcggccattccgaacgg
cgccaggatcatggcgagaccgatgccgttgtcgccgcgaaagcggaggcggcggcagcc
gcaggcctcgtcccgatcgtctgcgtcggtgagacgctggatcagtacaaggccggcgag
ggcgttgcggtggtggaaacgcaggtcgacggctccgtcccggcctccgcctcggccgac
cgtctggtggtggcctacgagccggtctgggcgatcggctcgggtctggtgcccacgacc
gacgatatccgtgcggtgcatggcgcgatccgtgcgcgcctggcggcgcgcttcggcgat
gccgcccagggcatccgcatcctctatggcggttcggtgaagcccggcaacgcagccgag
atcctgggggtcgacgatgtcgacggcgccctggtcggcggtgccagcctcaacgccgca
gacttcctggccatcggggcggcggcaccggcccgctga

DBGET integrated database retrieval system