KEGG   Tistrella mobilis: TMO_1760Help
Entry
TMO_1760          CDS       T02128                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tmo  Tistrella mobilis
Pathway
tmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01130  Biosynthesis of antibiotics
tmo01230  Biosynthesis of amino acids
Module
tmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TMO_1760 (trpC)
Enzymes [BR:tmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TMO_1760 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFK53599
UniProt: I3TLG1
Position
1946190..1947005
Genome map
AA seq 271 aa AA seqDB search
MAGDTLARICADKRDHIARKKAETPLAALEDRLGEASAPRGFRKALAARTVQGLPALIAE
VKKASPSKGLIRADFDPASLARAYAAAGAACLSVLTDTPYFQGEDAYLVAARGAVDLPVL
RKDFMLDPYQVMEARALGADCILLIMAALDDGQAAELEAAAFELGMDVLIEVHDRPELDR
ALRLKSPLLGINNRNLKTLVVDLQTSIELAAAVPADRELVCESGLDGPDALTRMMGHGMF
RFLVGESLMRQNDVEAATRHLLSARAPAAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgataccctcgcccggatctgcgccgacaagcgcgaccacatcgcccgcaag
aaggccgagacgccgcttgcggcacttgaggaccggctcggcgaagcctcggcgccgcgc
ggctttcgcaaggctctggccgccagaacggtgcagggccttccggccttgatcgccgag
gtcaagaaggcctcaccctccaagggactgatccgcgccgatttcgaccccgcatcgctt
gctcgcgcctatgccgcggccggggcggcctgcctgtcggtgctgaccgacacgccctat
ttccagggcgaggatgcctatctggtcgcggcgcgtggagcggtcgacctgccggtgctg
cgcaaggacttcatgctcgacccctatcaggtgatggaggcacgcgcgctcggcgccgac
tgtatcctgctgatcatggcggcacttgacgatggtcaggcggcagagcttgaagcggcg
gcgttcgagcttggcatggatgtgctgatcgaggttcacgatcgcccggaactcgatcgt
gcccttcgactgaagagcccgcttctcggcattaataatcgcaatctcaagaccctggtg
gtcgatcttcagacctcgatcgagcttgcggccgcggtgcccgccgatcgggaactggtc
tgcgaaagcgggctcgacggccccgatgcgctcacgcggatgatggggcatggcatgttc
cgcttcctggtcggcgaaagcctgatgcgacagaacgacgtcgaggcggcgacccgccat
ctgctgtcggcgcgggcgccggccgcggcggagtga

DBGET integrated database retrieval system