KEGG   Tistrella mobilis: TMO_1776Help
Entry
TMO_1776          CDS       T02128                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tmo  Tistrella mobilis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tmo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1964890..1965945)
Genome map
AA seq 351 aa AA seqDB search
MTANGNVEQLARDAVQLKARLAVTADPARYADLKACLSGSGIDVAAGPEALIEAAQRPAD
WVMAAIVGSAGLAPTLAAVRRGALVALANKECLVCAGDLFTAEVERHGARLLPADSEHNA
IAQILEPERLHVVEKVILTASGGPFRSLTLDQMRQVTPEQAVAHPNWSMGAKISVDSASM
MNKGLELIEAHHLFPVGLDRLDVLVHPQSIIHGLVQYADGSVLAHLGAPDMRTPIAWTLA
WPDRRPAPSDRLDLARIATLSFEAPDVTRFPCLALARDALKCGDGAATILNAANEVAVAA
FLARRIGFLDIAGVVADTLEAEPRRAPGSIDEVIALDAAARRRAVALVDAR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgccaacggcaatgtagagcagctggcgcgcgatgccgttcagctgaaggcgcgg
ttggcggtgaccgccgatcctgcacgctatgccgatctgaaggcatgcctttccggcagc
ggtatcgacgtggcggccggaccagaggccttgatcgaggcggcacaacgcccggcggac
tgggtgatggcggcaatcgtgggctcggccggtctggcgccgacgctggcggccgtgcgt
cgtggcgcgctcgtggcgctcgccaacaaggaatgcctcgtctgtgccggcgatctgttc
acggccgaagtggaacgtcatggcgcccggctgctgccggccgacagcgagcacaacgcc
atcgcccagatcctggaacctgagcgcctgcatgtggtcgagaaggtcattctgaccgcc
tcgggtggcccgttccggagcttgaccctcgatcagatgcgccaggtgacgccggagcag
gcggttgcccatcccaactggtcgatgggggcgaagatctcggtcgacagcgcgtcgatg
atgaacaaggggctggaactgatcgaggcacatcatctgtttccggtgggtctcgaccgc
ctcgacgtgctggtccatccgcagtcgatcattcatggattggtccagtatgccgatgga
tcggtgctggctcatctgggcgcgccggacatgcgcaccccgatcgcctggacgctggcc
tggcccgaccggcggccggcgccgagcgacaggctggatctggcgaggatcgcaacgctg
tcgtttgaagcgccggatgtgacgcggttcccctgtctggccctcgcccgcgacgccttg
aaatgcggggacggcgccgccacaatcctgaatgccgcgaacgaggtggctgtggcggcc
ttccttgcccgccggatcggcttcctcgacattgccggtgtcgtggccgatacgctggaa
gcagagcctcgccgggcccccgggtcgatcgacgaggtgatcgcactcgacgcagcggcc
cgtcgccgggctgtggccctggtggacgcccgttga

DBGET integrated database retrieval system