KEGG   Tistrella mobilis: TMO_1987Help
Entry
TMO_1987          CDS       T02128                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tmo  Tistrella mobilis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tmo00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tmo00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2203839..2205347)
Genome map
AA seq 502 aa AA seqDB search
MTDTVTPVQTTLQTTLPVPAQAAVTPPPATDAGAEGPGFFDRTLDRLNRLWREVSQQARA
RIGAPIRADLPAEDLDRIRALIRQSLDAVGGEVSARARTAELGQVYLGLAPKGKTAFLGL
LANEFDVPPGELDAAMLAVREAGVDQTARVAALERLRATLVSPRARLLRQFSSLPQGVKF
LVDLRADLLPLARTDPAARGMEHELREVLSGLFDIGLLDLTRITWDAPAALLEKLIEYEA
VHEIRSWSDLRNRLESDRRCYAFFHPKMPREPLIFVEVALVKGLAGDVHTLLDEAAPTAD
PEAADTAIFYSISNAQKGLAGFSFGNFLIKRVVEDLSHDLPNLKTFATLSPIPGFRAWLD
ECLAAGGEGLISEAERSRLKAALPREAEGHPLAVALEHDWPAEPQLAEALKAPLMRLAAR
YLTQEKTRGRARDGVAHFHLSNGARVERINWRADLSTKGVRQSAGMMVNYLYKRGEIEDN
HEAYTGGTHDVRAGSAVRGLLR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacaccgtgacgccagtgcagacaaccctgcagaccacacttcccgttcccgcc
caagctgccgtcacgccgccccctgcgaccgatgccggtgccgagggtccgggctttttc
gaccggaccctggaccggctgaaccggctgtggcgcgaggtgtcgcagcaggcgcgggcg
cgcatcggcgcgccgatccgcgccgacctgccggctgaggatctggaccggatccgggcg
ctgatccgtcagtcgcttgatgccgtgggcggcgaggtgtcggcgcgggcgcgcacggcc
gaactggggcaggtctatctggggcttgccccgaaaggcaagactgccttcctgggcctg
ctcgccaacgaattcgacgtgccgccgggagagctggacgcggccatgctggcggtgcgt
gaagcgggggtagaccagacagcgcgggtggccgcgctggaacggctgcgggcgacgctg
gtcagcccgcgggcgcggttgctgcgccagttcagcagcctgccgcagggcgtgaagttc
ctggtcgacctgcgcgccgacctgctgccgctggcccgcaccgacccggccgcgcggggc
atggagcacgaactgcgcgaggtactgtcgggcctgttcgacatcggcctcctggacctg
acccggatcacctgggatgcgcctgccgccctgctcgaaaagctgatcgaatacgaggcg
gtgcacgagatccgttcgtggtcggatctgcgcaacaggctggaaagcgaccggcgctgc
tatgccttcttccatccgaagatgccgcgcgagccgctgatcttcgtggaagtggccctg
gtcaagggtttggccggcgatgttcacaccctattggacgaggcggcgccgacagccgac
ccggaagccgccgacacggcaatcttttattcgatttcgaatgcccagaagggcctggcg
ggtttcagcttcggcaatttcctgatcaagcgggtggtcgaggacctgtcccatgatctg
cccaacctcaagactttcgcgaccctgtcgccgatccccggcttcagggcctggctggac
gagtgcctggcggccggcggcgaggggctcatctccgaggcggaacggtcgaggctgaag
gccgccctgcccagagaagcggagggtcatccgttggcggtcgcgctggagcacgactgg
ccggccgagcctcagcttgccgaggctttgaaggcaccgctgatgcgactggcggctcgc
tatctcacccaggagaagacccgcggccgggcacgggacggcgtggcgcatttccacctg
tccaatggcgcgcgggtggagcggatcaactggcgggccgatctcagcaccaagggggtc
cgtcagtcggccggcatgatggtcaactatctctataagcgtggcgagatcgaggacaac
cacgaggcctataccggcggcacgcatgacgtccgggccggctctgccgtgcgggggctg
ctgcgctga

DBGET integrated database retrieval system