KEGG   Tistrella mobilis: TMO_2693Help
Entry
TMO_2693          CDS       T02128                                 

Gene name
recR
Definition
Recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
tmo  Tistrella mobilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TMO_2693 (recR)
DNA repair and recombination proteins [BR:tmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TMO_2693 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2976645..2977244
Genome map
AA seq 199 aa AA seqDB search
MAAPEIEKLVTLLARLPGLGPRSARRAALTLLRRREALMLPLADALAKAAAEVKSCTICG
NLDARDPCGVCADERRDPAQLCVVEQVADLWAMERAGAFRGRYHVLGGTLSALDGIGPDE
LGIPKLAARVAEGGVTEVVMALPATVDGQTTAHYIADRLAEAAPEANITRLAHGMPVGGA
LDYMDDGTIQAALKARRPV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacccgagatcgagaagctcgtgaccctgctcgcccgcctgccggggctgggc
ccgcgctcggccaggcgcgcggcgctgaccctgctgagacggcgcgaggcgctgatgctg
ccgctggccgacgcgctggccaaggcggcggccgaggtcaagagctgcacgatctgcggc
aatctggatgcccgcgacccctgcggggtctgcgccgacgagcggcgcgacccggcccag
ctctgcgtggtggaacaggtggcggatctctgggcgatggagcgcgccggtgctttccgc
ggccggtatcacgtgctggggggcacgctctcggcgctcgacggcatcggtcccgacgaa
ctcggcatcccgaaactggcggcacgggtcgcggaaggcggcgtcaccgaggtggtgatg
gccctccccgccaccgtcgacggccagaccaccgcccattacatcgccgaccggctggcg
gaagcggcgcccgaggccaacatcacccgcctcgcccatggcatgccggtgggcggcgcg
ctcgactatatggatgacggcaccattcaggcggcgctcaaggcgcgccggccggtctga

DBGET integrated database retrieval system