KEGG   Tistrella mobilis: TMO_2693Help
Entry
TMO_2693          CDS       T02128                                 

Gene name
recR
Definition
(GenBank) Recombinational DNA repair protein (RecF pathway)
  KO
K06187  recombination protein RecR
Organism
tmo  Tistrella mobilis
Pathway
tmo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TMO_2693 (recR)
DNA repair and recombination proteins [BR:tmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TMO_2693 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TMO_2693 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: AFK54531
UniProt: I3TP43
Position
2976645..2977244
Genome map
AA seq 199 aa AA seqDB search
MAAPEIEKLVTLLARLPGLGPRSARRAALTLLRRREALMLPLADALAKAAAEVKSCTICG
NLDARDPCGVCADERRDPAQLCVVEQVADLWAMERAGAFRGRYHVLGGTLSALDGIGPDE
LGIPKLAARVAEGGVTEVVMALPATVDGQTTAHYIADRLAEAAPEANITRLAHGMPVGGA
LDYMDDGTIQAALKARRPV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacccgagatcgagaagctcgtgaccctgctcgcccgcctgccggggctgggc
ccgcgctcggccaggcgcgcggcgctgaccctgctgagacggcgcgaggcgctgatgctg
ccgctggccgacgcgctggccaaggcggcggccgaggtcaagagctgcacgatctgcggc
aatctggatgcccgcgacccctgcggggtctgcgccgacgagcggcgcgacccggcccag
ctctgcgtggtggaacaggtggcggatctctgggcgatggagcgcgccggtgctttccgc
ggccggtatcacgtgctggggggcacgctctcggcgctcgacggcatcggtcccgacgaa
ctcggcatcccgaaactggcggcacgggtcgcggaaggcggcgtcaccgaggtggtgatg
gccctccccgccaccgtcgacggccagaccaccgcccattacatcgccgaccggctggcg
gaagcggcgcccgaggccaacatcacccgcctcgcccatggcatgccggtgggcggcgcg
ctcgactatatggatgacggcaccattcaggcggcgctcaaggcgcgccggccggtctga

DBGET integrated database retrieval system