KEGG   Tistrella mobilis: TMO_2804Help
Entry
TMO_2804          CDS       T02128                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tmo  Tistrella mobilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TMO_2804 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TMO_2804 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TMO_2804 (thrC)
Enzymes [BR:tmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TMO_2804 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3107065..3108468)
Genome map
AA seq 467 aa AA seqDB search
MQYISTRGRAPRLDFGQVLLDGLARDGGLYLPESWPRVEPATMRAWRGLDYAGLAKQVMR
LFVGTTIAPADLDRMIDDTYAGFGHKAVAPLKQLGANEWVMELFHGPTLAFKDFALQLLG
RLFDHALDRSDRRGVILGATSGDTGSAAIEACRDRARLDVFILHPLGRTSEVQRRQMTTV
LSPNVHNIAIRGTFDDAQDMVKAAFGDEAFRDQVGLTAINSINWARIAAQVVYYFHAALA
LGAPDREVAFAVPTGNFGDVYAGYIAASMGLPVAKLIVATNENDILARFFRNGDYSSAGV
RPTWSPSMDIQVASNFERLLFDLKGRDGEATAAAIRTFRETGHLPVSDAEIAKARLLFDA
GAADDARTIDTIARVFAETGEILDPHTAVGVAVARDRREGVPAGTPVVVLATAHPAKFPD
AVEKAIGRRPALPARMADLMERPERYDTLEADVSILTSHILSHRRNA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtacatcagcacccgcggccgcgcgccgcggctcgatttcggtcaggttctcctc
gacggtctcgcccgcgacggcggcctctatctgcccgagagctggccccgggtcgagccg
gccaccatgcgggcctggcgggggctggattatgcgggccttgcgaagcaggtgatgcgg
ctcttcgtcggcacgaccattgcgccggccgatctcgaccggatgatcgacgacacctat
gccggcttcggccacaaggcggtggcgccgctgaagcagctgggcgccaatgaatgggtg
atggagctgttccacggcccgaccctcgccttcaaggatttcgccctgcagctgctgggc
cggctgttcgatcatgcgctggatcggtccgaccggcgcggcgtgatcctgggcgccacc
tcgggcgataccggctcggcggcgatcgaggcctgccgcgaccgcgcgcggctggacgtg
ttcatcctgcatcccttgggccgcacctccgaggtgcagcgccggcagatgaccaccgtg
ctctcgcccaatgtccacaacatcgccatccgcggcaccttcgacgatgcccaggacatg
gtgaaggcggctttcggtgacgaggccttccgcgaccaggtcgggctgaccgcgatcaac
tcgatcaactgggcccgcatcgccgcccaggtggtctattacttccacgccgctctggcc
ctgggggcgcccgatcgcgaggtcgccttcgccgtgccgaccggcaatttcggcgacgtc
tatgccggctatatcgcggcctcgatgggcctgccggtggcgaagctgatcgtggccacc
aacgagaacgacatcctggcgcggttcttccgcaatggcgactattcctcggccggcgtg
cggccgacctggagcccgtcgatggacattcaggtcgccagcaatttcgagcggctgctc
ttcgatctgaagggccgcgacggcgaggcgaccgcggctgcgatccgcaccttccgcgaa
accggccatctgccggtcagcgatgccgagatcgccaaggcccgactgctcttcgatgcc
ggtgcggccgacgacgcccgcaccatcgacaccatcgcccgtgtcttcgccgagaccggc
gagatcctggatccgcacaccgccgtgggcgtggcggtggcccgcgaccgccgcgagggc
gtgccggccggcacgccggtggtggtgctggcgaccgcccatccggccaagttcccggat
gcggtggaaaaggcgatcggccgtcgtccggccctgcctgcacgcatggcagacctgatg
gagcggccggagcgatatgacacgctggaggctgacgtttcgatcctgacctcccatatc
ctgtcgcaccgccgcaacgcctga

DBGET integrated database retrieval system