KEGG   Tistrella mobilis: TMO_3008Help
Entry
TMO_3008          CDS       T02128                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tmo  Tistrella mobilis
Pathway
tmo00020  Citrate cycle (TCA cycle)
tmo00640  Propanoate metabolism
tmo00660  C5-Branched dibasic acid metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
Module
tmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TMO_3008 (sucC)
   00640 Propanoate metabolism
    TMO_3008 (sucC)
   00660 C5-Branched dibasic acid metabolism
    TMO_3008 (sucC)
Enzymes [BR:tmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TMO_3008 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFK54846
UniProt: I3TQ08
Position
complement(3324267..3325436)
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQAKALLAKYGVAVPRGGVAYTPEEAVEVAKSLGGPVWVVKAQIHAGGRGKAGGV
KVVKSLDDVAATAKNMLGMTLVTHQTGPEGKEVKRVYIEEGCDIRRELYLGVVIDRETSS
VTFMASTEGGMEIEEVAKETPEKIIKVPVDVITGMQPFHARKIAYGLGLEGKQVSVATKF
MLAMYQAVIGTDASIVEINPLVVTGAGDVIALDAKMNFDDNALFRHKDIEDLRDESEEDP
SELEASRHALNYIKLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGGGATRERVTT
AFKLILSDPNVEGILVNIFGGIMRCDVIAEGVVAAAREISLQVPLVVRLEGTNVEKGKAI
LANSGLPIMSADDLADAAEKIVKAVKEAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaagcgaaggcgctcctcgcgaagtacggcgtcgcggtgccc
cgcggcggcgtcgcctacacgccggaagaggcggtcgaggtcgccaagagcctgggtggc
ccggtctgggtcgtgaaggcccagatccacgccggcggccgcggcaaggccggcggcgtc
aaggtcgtgaagtcgctcgacgacgtcgctgcgaccgcgaagaacatgctcggcatgacc
ctggtcacgcaccagaccggtcccgagggcaaggaagtcaagcgggtctacatcgaggaa
ggctgcgacatccgtcgtgagctgtatctcggcgtcgtcatcgaccgcgagacctcgtcg
gtgaccttcatggcctcgaccgaaggcggcatggagatcgaagaggtcgcgaaagagacc
cctgagaagatcatcaaggtgccggtcgacgtcatcaccggcatgcagcccttccacgcc
cgcaagatcgcctacggtctcggcctggaaggcaagcaggtgtcggttgcgaccaagttc
atgctcgccatgtaccaggccgtgatcgggaccgatgcgagcatcgtcgagatcaacccg
ctggtcgtgaccggcgcgggcgacgtcatcgcgctcgacgcgaagatgaatttcgacgac
aacgccctgttccgtcacaaggacatcgaggacctgcgcgacgagagcgaggaggatccc
tccgagctggaagcctcgcgtcacgccctcaactacatcaagctcgacggcaacatcggc
tgcatggtcaacggcgcgggtctcgcgatggcgaccatggacatcatcaagctgtatggc
ggcgagccggcgaacttcctggacgtcggtggcggtgcgacccgcgagcgcgtgaccacg
gccttcaagctgattctctcggaccccaatgtcgaggggattctcgttaacatctttggc
ggtatcatgcgttgcgacgtgatcgccgagggtgtcgtggctgcggcccgcgagatcagc
ctccaggttccgctggtggtgcgtctcgagggcacgaacgtcgagaagggcaaggcgatc
ctggccaattccggcctgccgatcatgtccgccgacgatctggccgacgctgccgagaag
atcgtgaaagccgtgaaggaggccgcctga

DBGET integrated database retrieval system