KEGG   Tistrella mobilis: TMO_3041Help
Entry
TMO_3041          CDS       T02128                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tmo  Tistrella mobilis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    TMO_3041
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TMO_3041
Enzymes [BR:tmo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     TMO_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3358977..3359543
Genome map
AA seq 188 aa AA seqDB search
MIFHETPVDGVRVIEPERRGDDRGFFARVYCEREFAEAGLVNHYVQVNNSLSAKKGTLRG
MHYQLAPSSEVKLVRCVRGALWDAVLDLRPDSPTFGKWFGAELTAENRLMMYVPRGFAHG
FVTLTEDTEAFYLVSDFYAPQEERGIRWNDPRFGIEWPVEPTEISAKDAAWPDYDPEYHG
VERFRGIK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcttccacgagacccccgtcgacggcgtgcgtgtgatcgaaccggaacgccggggc
gatgaccgtggtttcttcgcccgtgtctattgcgagcgtgagttcgcagaggcaggcctt
gtgaaccattacgttcaggtcaacaactcgctttcggccaagaagggcaccctgcgcggg
atgcactatcagttggccccctcgtccgaggtcaagctggtccggtgtgtgcgcggcgcc
ctttgggatgcggttcttgacctgcgtccggactccccgaccttcggcaagtggttcggc
gccgaactgacggccgagaaccggctgatgatgtacgtgccgcgcggcttcgctcatggc
ttcgtcacgctgaccgaggataccgaggccttctatctggtgagcgatttctatgcgccc
caggaggaacgcggcatccgctggaatgatccgcgcttcggcatcgagtggcccgtggag
ccgaccgagatctccgcaaaagacgccgcctggccggattatgaccccgagtatcacggg
gtcgagcgtttcagggggatcaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system