KEGG   Tistrella mobilis: TMO_3155Help
Entry
TMO_3155          CDS       T02128                                 

Gene name
yddV
Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
tmo  Tistrella mobilis
Brite
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     TMO_3155 (yddV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3479436..3480347
Genome map
AA seq 303 aa AA seqDB search
MAYVHEAGRDPELSRAIDGLLTDGGQLTPDFLREAFERHFGMAREAQAVREGGARLAAEA
ERALSAAEGARSALDTAADEAQRLADRLEQGDTIDPRRLAEAARGLALLARRTAQRTEGA
VRSLDAATDQIGGVRRDLDKVRRELATDPLTGLANRRHFELRLGEEIALARETGDPLTVM
LVDVEGFDAIAAAHGPGIGDQVLRLVGKTLADGVRGRDVAARFGAQRFAVALPHTTESES
GAIAEQIRNIVSGRRIVRRDNREAVGRIALSVSRATLQPGEDIGRLIARAEAGLDGRRTR
SAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggcctatgtccacgaggccggtcgcgatccggaactgagccgggcgatcgacgggctg
ttgaccgatggcgggcagctgaccccggatttcctgcgggaagccttcgagcggcatttc
ggaatggcccgcgaggcccaggcggtccgcgaaggtggtgcccggcttgcagcagaggcg
gaacgcgcgctcagcgccgcagaaggcgcccgttcggctctcgatacggccgccgacgag
gcccagcgcctggctgaccggctggagcagggcgacacgatcgacccccgccgcctggcc
gaggcggcccgggggctggcgctgttggcccggcgcacggcccagcggaccgagggcgcg
gtgcgttcgctcgatgccgccaccgatcagatcggcggtgtccgccgcgatctggacaag
gtccggcgcgaactcgccaccgatccgctcaccggtcttgccaaccgccggcatttcgag
ctgcgcctgggcgaggagatcgcactggcccgcgagaccggcgacccgctgaccgtcatg
ctggtcgatgtcgaaggcttcgacgccatcgccgccgcccatgggcccggcatcggcgac
caggtgttgcggctggtgggcaagacgctcgccgacggtgtgcgcggacgtgacgtcgcc
gcccgcttcggtgcccagcgcttcgccgttgccctgccccacaccaccgaaagtgaatcc
ggggccatcgccgagcagatccgcaacatcgtctcgggccggcggatcgtgcgtcgcgac
aaccgggaagcggtgggccggatcgcgctctcggtctcgcgcgcgaccctgcagccgggc
gaggatatcggccggctgatcgcccgcgccgaggcaggtctggacggccgccgcacccgc
agcgcccgctga

DBGET integrated database retrieval system