KEGG   Tistrella mobilis: TMO_3190Help
Entry
TMO_3190          CDS       T02128                                 

Gene name
cycM
Definition
putative CytoChrome c-like protein
Orthology
K08738  
cytochrome c
Organism
tmo  Tistrella mobilis
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tmo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3515083..3515700)
Genome map
AA seq 205 aa AA seqDB search
MSGFEFNKLMAAFLTAALFAMVVGVISDMVYEPEHLEKNAYAIEGVATDAAAEAPKEVPF
EVALASADPKAGAKVFARCTACHDDSKGGPNKVGPELWSVVGRPVASADGFAYSDALKGI
GGEWTFEKLDHFLTKPASFAPGTKMSFAGLSKVEDRAAVIAYLNSQSDAPKEIPAAPAEG
GAEGGEQPAAEQPAGEQPAAQQNAG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcttcgaattcaacaagctgatggccgcgttcctgacggcggcattgttcgcc
atggtcgtgggtgtcatctccgacatggtgtacgagcctgaacacctggagaagaacgcc
tacgcgatcgaaggcgtcgccaccgacgccgccgccgaggcgccgaaggaagtgccgttc
gaggtggcgctggccagtgccgaccccaaggccggtgccaaggtcttcgcccgctgcacc
gcctgccacgacgactcgaagggtggcccgaacaaggtcggccccgagctgtggagcgtg
gtcggccgcccggtggcctctgccgacggcttcgcctattccgacgccctgaagggcatc
ggcggcgagtggaccttcgagaagctcgaccacttccttaccaagccggcctcgtttgcg
ccgggcaccaagatgtccttcgccggcctgtcgaaggtcgaggatcgcgccgcggtcatt
gcctatctcaacagccagtcggatgcccccaaggagatcccggcggcgcccgccgagggg
ggggccgaaggtggtgagcagcccgctgccgaacagccggccggcgagcagcccgccgcc
cagcagaacgccggctga

DBGET integrated database retrieval system