KEGG   Tistrella mobilis: TMO_3190Help
Entry
TMO_3190          CDS       T02128                                 

Gene name
cycM
Definition
putative CytoChrome c-like protein
Orthology
K08738  
cytochrome c
Organism
tmo  Tistrella mobilis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TMO_3190 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TMO_3190 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3515083..3515700)
Genome map
AA seq 205 aa AA seqDB search
MSGFEFNKLMAAFLTAALFAMVVGVISDMVYEPEHLEKNAYAIEGVATDAAAEAPKEVPF
EVALASADPKAGAKVFARCTACHDDSKGGPNKVGPELWSVVGRPVASADGFAYSDALKGI
GGEWTFEKLDHFLTKPASFAPGTKMSFAGLSKVEDRAAVIAYLNSQSDAPKEIPAAPAEG
GAEGGEQPAAEQPAGEQPAAQQNAG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcttcgaattcaacaagctgatggccgcgttcctgacggcggcattgttcgcc
atggtcgtgggtgtcatctccgacatggtgtacgagcctgaacacctggagaagaacgcc
tacgcgatcgaaggcgtcgccaccgacgccgccgccgaggcgccgaaggaagtgccgttc
gaggtggcgctggccagtgccgaccccaaggccggtgccaaggtcttcgcccgctgcacc
gcctgccacgacgactcgaagggtggcccgaacaaggtcggccccgagctgtggagcgtg
gtcggccgcccggtggcctctgccgacggcttcgcctattccgacgccctgaagggcatc
ggcggcgagtggaccttcgagaagctcgaccacttccttaccaagccggcctcgtttgcg
ccgggcaccaagatgtccttcgccggcctgtcgaaggtcgaggatcgcgccgcggtcatt
gcctatctcaacagccagtcggatgcccccaaggagatcccggcggcgcccgccgagggg
ggggccgaaggtggtgagcagcccgctgccgaacagccggccggcgagcagcccgccgcc
cagcagaacgccggctga

DBGET integrated database retrieval system