KEGG   Tistrella mobilis: TMO_3198Help
Entry
TMO_3198          CDS       T02128                                 

Gene name
tesA
Definition
SGNH hydrolase-type arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tmo  Tistrella mobilis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tmo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3524000..3524653
Genome map
AA seq 217 aa AA seqDB search
MLGLIGLGLTALLVRPGPLGAAENQPLILALGDSLTAGYGLPEGEGLVPQLEAALAAAGR
PAQVENAGVSGDTTAGGRARLDWALGGLPRQPDLVIVALGANDALRGIAPDEAKANLDAI
LDTLGRKGLPVLLVGMLAPTNWGPDYRRAFDAIYPDLAGTHDVPLDPFILEGVALEPSLV
QPDGLHPNVAGVEKMAARLAPVVIGALDARKVPKVSD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgctggggctgatcggcctcggcctcaccgcccttcttgtccgccccggccccctcggc
gccgcagagaaccagccgctgatcctggcgctcggcgacagcctgaccgccggctatggc
ctgccggaaggcgagggcctggtgccgcagcttgaagccgccctggccgccgccggccgg
ccggcacaggttgagaatgccggggtttcgggcgacaccaccgccggtggtcgggcccgg
ctcgactgggccctggggggcctgccccgccagccggatctggtgatcgtggcactcggc
gccaacgacgccctgcgcggcatcgcccccgacgaggccaaggccaatctggacgccatt
ctggacacgctcggccgcaagggcctgccggtgctgctggtcggcatgctggccccgacc
aattggggcccggactatcgcagggccttcgatgccatttatcccgatctcgccggcacc
cacgacgtgccgctcgaccccttcattctggagggcgtggcgctggagccgtcactcgtt
cagcccgacggtctgcacccgaatgtggcgggggtggagaagatggcggcacggctggca
cccgtggtgatcggggcacttgatgcccggaaggtgccgaaggtgagtgactga

DBGET integrated database retrieval system