KEGG   Tistrella mobilis: TMO_3234Help
Entry
TMO_3234          CDS       T02128                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tmo  Tistrella mobilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TMO_3234 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TMO_3234 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TMO_3234 (trpB)
Enzymes [BR:tmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TMO_3234 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3558529..3559743
Genome map
AA seq 404 aa AA seqDB search
MSHTPNTYRSGPDEHGRFGLFGGRFVAETLMPLILELERAYEAARQDPGFAAEMALFQRD
YVGRPSPLYLAERLTEHLGGAKIYFKRDELNHTGAHKINNVLGQLLVAKRMGKKRIIAET
GAGQHGVATATMCARLGMDCVVYMGETDIVRQKPNVFRMRLLGAEVRGVSSGTATLKDAM
NEALRDWVSNVDDTFYCIGTAAGPHPYPMMVRDFQSIIGEETKAQVLEREGRLPDMLVAC
IGGGSNAIGLFHPFLDDDGVRMIGVEAAGHGIETGEHAASLAGGRPGVLHGNRTYLLQDA
DGQILNAHSISAGLDYPGIGPEHSWLRDIGRVEYAAVTDREALDAFQLCARLEGILPALE
PAHAVAQVVKTAPTLARDAILVMNMCGRGDKDVFTVAEALGVDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatacacccaacacctaccgttccgggccggacgagcacggccgtttcggactg
ttcggcggccgtttcgtcgccgagaccctgatgccgctgatcctggagcttgagcgggcc
tacgaggcggcgcggcaggatcccggatttgccgccgagatggccctgtttcagcgcgac
tatgtcggccggccgagcccgctctatctggccgaacggctgacggagcatctgggcggc
gcgaagatctacttcaagcgcgacgagctgaaccacaccggcgcgcacaagatcaacaac
gtgctgggccagctgctggtcgcgaagcgcatgggcaagaagcggatcatcgccgagacc
ggcgccggtcagcatggcgtcgccaccgccaccatgtgcgcgcgcctcggcatggactgc
gtcgtctatatgggcgaaaccgacatcgtccgccagaagcccaacgtgttccgcatgcgc
ctgctcggcgccgaggtgcgcggcgtgtcgtcgggcaccgcgaccctcaaggatgcgatg
aacgaagccctgcgggactgggtgtcgaatgtcgacgacaccttctactgcatcggcacc
gcggccgggccgcacccctatccgatgatggtccgcgatttccagtcgatcatcggcgag
gagacgaaggcccaggttctggagcgcgaaggccggctgcccgacatgctggtcgcctgc
atcggcggcggttccaacgccatcggcctgttccatcccttcctcgacgacgacggggta
cggatgatcggcgtcgaggcggcgggccacggcatcgagaccggcgaacatgccgcctcg
ctggccggcggccgtccgggcgtgctgcacggcaaccgcacctatctgctgcaggatgcc
gacgggcagatcctgaacgcccattcgatctcggccggcctggactatcccggcatcggc
cccgagcattcctggctgcgcgatatcggccgggtggaatatgcggccgtcaccgaccgc
gaggcgctcgacgccttccagctctgcgcgcgccttgaaggcatcctgccggcgctggaa
cccgcccatgcggtggcgcaggtggtcaagaccgcccccaccctggcccgcgacgccatt
ctggtgatgaacatgtgcggccgcggcgacaaggacgtcttcaccgtcgccgaagccctg
ggagtggacctgtga

DBGET integrated database retrieval system