KEGG   Tistrella mobilis: TMO_3234Help
Entry
TMO_3234          CDS       T02128                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tmo  Tistrella mobilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TMO_3234 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TMO_3234 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TMO_3234 (trpB)
Enzymes [BR:tmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TMO_3234 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3558529..3559743
Genome map
AA seq 404 aa AA seqDB search
MSHTPNTYRSGPDEHGRFGLFGGRFVAETLMPLILELERAYEAARQDPGFAAEMALFQRD
YVGRPSPLYLAERLTEHLGGAKIYFKRDELNHTGAHKINNVLGQLLVAKRMGKKRIIAET
GAGQHGVATATMCARLGMDCVVYMGETDIVRQKPNVFRMRLLGAEVRGVSSGTATLKDAM
NEALRDWVSNVDDTFYCIGTAAGPHPYPMMVRDFQSIIGEETKAQVLEREGRLPDMLVAC
IGGGSNAIGLFHPFLDDDGVRMIGVEAAGHGIETGEHAASLAGGRPGVLHGNRTYLLQDA
DGQILNAHSISAGLDYPGIGPEHSWLRDIGRVEYAAVTDREALDAFQLCARLEGILPALE
PAHAVAQVVKTAPTLARDAILVMNMCGRGDKDVFTVAEALGVDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatacacccaacacctaccgttccgggccggacgagcacggccgtttcggactg
ttcggcggccgtttcgtcgccgagaccctgatgccgctgatcctggagcttgagcgggcc
tacgaggcggcgcggcaggatcccggatttgccgccgagatggccctgtttcagcgcgac
tatgtcggccggccgagcccgctctatctggccgaacggctgacggagcatctgggcggc
gcgaagatctacttcaagcgcgacgagctgaaccacaccggcgcgcacaagatcaacaac
gtgctgggccagctgctggtcgcgaagcgcatgggcaagaagcggatcatcgccgagacc
ggcgccggtcagcatggcgtcgccaccgccaccatgtgcgcgcgcctcggcatggactgc
gtcgtctatatgggcgaaaccgacatcgtccgccagaagcccaacgtgttccgcatgcgc
ctgctcggcgccgaggtgcgcggcgtgtcgtcgggcaccgcgaccctcaaggatgcgatg
aacgaagccctgcgggactgggtgtcgaatgtcgacgacaccttctactgcatcggcacc
gcggccgggccgcacccctatccgatgatggtccgcgatttccagtcgatcatcggcgag
gagacgaaggcccaggttctggagcgcgaaggccggctgcccgacatgctggtcgcctgc
atcggcggcggttccaacgccatcggcctgttccatcccttcctcgacgacgacggggta
cggatgatcggcgtcgaggcggcgggccacggcatcgagaccggcgaacatgccgcctcg
ctggccggcggccgtccgggcgtgctgcacggcaaccgcacctatctgctgcaggatgcc
gacgggcagatcctgaacgcccattcgatctcggccggcctggactatcccggcatcggc
cccgagcattcctggctgcgcgatatcggccgggtggaatatgcggccgtcaccgaccgc
gaggcgctcgacgccttccagctctgcgcgcgccttgaaggcatcctgccggcgctggaa
cccgcccatgcggtggcgcaggtggtcaagaccgcccccaccctggcccgcgacgccatt
ctggtgatgaacatgtgcggccgcggcgacaaggacgtcttcaccgtcgccgaagccctg
ggagtggacctgtga

DBGET integrated database retrieval system