KEGG   Tistrella mobilis: TMO_3235Help
Entry
TMO_3235          CDS       T02128                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tmo  Tistrella mobilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TMO_3235 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TMO_3235 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TMO_3235 (trpA)
Enzymes [BR:tmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TMO_3235 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3559740..3560612
Genome map
AA seq 290 aa AA seqDB search
MSAMAETLDRSAVPGGTARIDRRFAALKAEGRAGLVTFVTAGDPDLDTGARVLAALAEAG
ADVIELGVPFTDPMADGPAIQRAGLRALAAGVTMIKVLDMVRAFRATDTDTPVILMGYYN
PIYAYGAERFAADAMAAGVDGLIVVDLPAEEEEELVRFTDPAGLALVRLVAPTTSVERLP
SVVGRASGFLYYVSITGITGTASADISRVAPSVARIRAASELPVAIGFGIKTPEQAAAFA
AIGDAVVVGSAIVQEVEQAVADGAPETAPDRVRDLVSRLAGGVQSAAARA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccatggctgagaccctcgaccgttccgccgtgccgggtggcaccgcccgcatc
gatcgccgtttcgcggcgctgaaggccgaaggccgggccgggctggtcaccttcgtgacc
gcgggcgaccccgatctcgacaccggcgcccgggtgctggccgcgctggccgaagcgggt
gccgacgtgatcgagctgggcgtgcccttcaccgacccgatggcggacggcccggcgatc
cagcgggcggggctgcgtgccctcgccgcaggcgtcaccatgatcaaggtgctggacatg
gtccgtgccttccgggcgaccgataccgatacccccgttatcctgatgggctattacaat
ccgatctacgcctatggtgccgagcgcttcgccgccgatgcgatggccgccggcgtcgac
gggctgatcgtggtcgatctgccggccgaggaagaggaggagctggtccgcttcaccgat
cccgcgggtcttgccctggtccgcctggtcgcccccaccacctcggttgagcgtctgccc
tcggtggtcgggcgggcgagcggcttcctctattatgtctcgatcaccggcatcaccggc
accgcctcggcagacatctccagggtggcaccgtcggtcgcccggattcgcgcggcgagc
gaattgccggtggcgatcggtttcggtataaagactcccgaacaggcagccgccttcgcg
gcgatcggtgatgccgtcgtggtcggctcggcgatcgtgcaggaggtcgaacaggcggtg
gccgacggcgcgcctgaaaccgcgccggaccgggtccgcgatctggtcagccggctggca
ggcggtgtgcagagcgctgccgcccgcgcctga

DBGET integrated database retrieval system