KEGG   Tistrella mobilis: TMO_3274Help
Entry
TMO_3274          CDS       T02128                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tmo  Tistrella mobilis
Pathway
tmo00020  Citrate cycle (TCA cycle)
tmo00190  Oxidative phosphorylation
tmo00650  Butanoate metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
Module
tmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tmo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TMO_3274 (sdhD)
   00650 Butanoate metabolism
    TMO_3274 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    TMO_3274 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS CPT
Motif
Other DBs
NCBI-ProteinID: AFK55112
UniProt: I3TQS4
Position
3603788..3604168
Genome map
AA seq 126 aa AA seqDB search
MSLRNPLARVRGLGSAKEGVQHWWLQRVTAMAMVPLTLWFVISVIAHLGAGRLEMVDWMS
SPVSAALMIAFLVSLFWHAKLGLQVVIEDYVHNEACKIASLTAMTFAVVIVGIACVVSVL
KLAFGG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcgcaatcccctcgcccgcgttcgcgggctgggctcggctaaagaaggtgtc
cagcactggtggcttcagcgggtgaccgccatggccatggtgccgttgaccctgtggttc
gtgatttcggtgatcgcgcatctgggcgccggccggctggagatggtggactggatgtcc
tcgccagtctccgccgcactgatgatcgctttcctggtcagcctgttctggcatgcaaaa
ctgggcctgcaggtcgtcatcgaggattacgtgcacaacgaggcatgcaagatcgcgtcg
ctgaccgccatgaccttcgccgtggtcatcgtcggcatcgcctgcgtcgtctcggtgctg
aagctcgccttcggaggctga

DBGET integrated database retrieval system