KEGG   Tistrella mobilis: TMO_a0047Help
Entry
TMO_a0047         CDS       T02128                                 

Gene name
asnB
Definition
Asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tmo  Tistrella mobilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tmo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM1:complement(46389..48329)
Genome map
AA seq 646 aa AA seqDB search
MVQSSAGFLAGTGGAVRDLARRCPSDFRIDRIHQGDGGVVVGLGRDNPTGRLRRPAPRSI
GAGPSGAVTLVNGEIYNLAGLARELGLDRTTPLTPVRLVDALLDRWGVDGLARLDGDYTL
VRWSPADRSLLLAACPMGRDSLCHAATPDGIVAASRPSWLLAVPEVDPEPDPEVLAYRLV
KMESRIGDRTPWRHIRRLQPGWYLEWQDGSTQTAPFWSPVPRRTLRLRRDAEYVEAAREH
LDRAVAARCPAGKPILCLLSAGLDSPGVAATASRSHDAPVHTLTIRADPDVPQLPPDAGH
FADEWERLQPFLARYPGLTPHLVDAWQPDLSMEYAGGPLQSRDWPVKRPYQISWMLLPLE
RTVREQDIGVVLSGDAGNVTLSYTGGRVAADQLRRGRALAAWRNLVPYRPELRGRPRLFW
GPRALWGQAVAPLAGPGIRRLTRRLRGGRDYWWQEWSSIRPEVAERLRLAEHDQPTVRTG
SPDLDNHIRLLEHFRQNNAQYAHLFQGMAWSWRDPYCDLGLVEFCLSLPRDQFRRNGVPR
LLARRTLADRVPQPILDERRIGLQHADWFGWMGRRRDWMAAEIDRIEQSPLACSILDTQH
MRAILDAWPATAEEAGRFPTSHRLRKGLGEALRVGQFILMQEGRNG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggttcagagcagcgccgggtttctggccggcaccggtggcgcggtgcgtgatctggcc
cgccgctgcccgtcggacttccgcatcgaccggattcaccagggtgacggcggtgtcgtc
gtcgggctgggccgcgacaacccgaccggccggctacggcgccccgcgccccgatcaatc
ggggcgggtccgtcaggcgcggtgacgctggtcaacggcgagatctacaatctcgccggt
ctggcccgagagctggggctggaccggacgacgccgctgacgccggtgcggctggtcgat
gcccttctcgaccggtggggcgtcgacgggctcgcccggctggatggcgactacaccctg
gtgcgctggtcgcccgccgatcgctcgctgctgctcgccgcctgcccgatggggcgggac
agcctgtgccatgccgccacgcccgacggcatcgttgcggccagccgacccagctggttg
ctggccgtcccggaggttgatccggaaccggaccccgaggtgcttgcctaccggctggtc
aagatggaaagccggatcggcgaccgcaccccctggcgccacatccggcgcctgcaaccg
ggctggtatctggaatggcaggacggatccacgcagacggcccccttctggtcaccggtg
ccgcggcgcacactgcgtctgcgccgggatgccgagtatgtggaggccgcgcgcgaacat
ctggaccgggcggtcgccgcgcgctgccctgccggcaaacccatcctgtgcctgctgtcg
gcagggctggattcccccggcgtcgccgcgacggcctcccgcagccatgacgcgcccgtc
cataccctcaccatccgcgccgatcccgatgttccccagctgcccccggatgccggtcat
ttcgccgacgagtgggagcgtctgcagcctttcctggcccgctatcccgggttgacgccg
catctggtcgatgcctggcaacccgacctttcgatggaatatgccggcgggccgctgcag
agccgcgactggccggtgaagagaccctatcagatatcctggatgctgttgcccttggag
cgcactgtgcgggaacaggacatcggcgtggtcctgagcggcgatgcgggcaatgtcacg
ctcagctataccggcggccgggtggcggccgatcagttgcggcgcgggcgggcgctggcg
gcctggcgcaacctcgttccctatcgcccggaattgcggggccggccacggctgttctgg
ggcccccgggcgctttggggtcaggcggtggcgcccctggccggccccggcattcgccgc
ctgacgcggcggttgcgcggcggccgggactattggtggcaggaatggagcagcatccgg
ccagaagtcgcggaacggttgcggctggcggaacacgatcagccgaccgtgcgcacgggc
tcgcccgatctcgacaaccatatccggctgctggaacatttccgccagaacaacgcccaa
tacgcccacctctttcagggcatggcctggtcctggcgcgatccgtattgcgatctgggc
ctggtggagttctgcctgtcgctgccgcgcgaccagtttcgccgcaacggggtgccgcgc
ctgctggcccgccgcaccctggcagaccgcgtgccgcagccgattctggatgagcgtcgg
atcggcctgcagcatgccgactggttcggctggatggggcggcggcgcgactggatggcg
gcagagatcgaccggatcgaacaatcacccctggcctgctccattctggatacgcagcat
atgcgcgcgatcctggatgcctggccggccaccgccgaagaggccgggcgcttccccacc
tctcaccgtctgcgcaaggggctgggcgaggcgctgcgggtggggcagttcatcctgatg
caggaaggccgcaatggctga

DBGET integrated database retrieval system