KEGG   Tistrella mobilis: TMO_a0211Help
Entry
TMO_a0211         CDS       T02128                                 

Gene name
malQ
Definition
glycoside hydrolase family protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tmo  Tistrella mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tmo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM1:complement(232637..234541)
Genome map
AA seq 634 aa AA seqDB search
MQALAAAAGIATSWTDAAGQGHSVTPDTLRALLAVLDLPADSPAQIRESLERAAALPPPR
PDAAMGPRCFGLDAALGQPGRPPRAWGATAQLYGLRRSGDPGCGDTTALAGLARSLGKAG
ACCLGVSPVHALFGADPHRWSPYAPSSRLFLNELIIDPDDIAGPAETARALETLGLAARA
RAAAAAPLVDWPEVAAVKRAVIDHLLKAHGARLAADADWQAFRAARGRALDDHAVFEVLD
ARFREQGLTGGWPSWPQDFRDPHGSSVANMAKSAAEAVDRARLRQWLAFRGLAGAQRAAT
DAGMGVGLIADLAIGVDGSGAQSWSERAGDLNGAGILTGASIGAPPDLFNPLGQNWGLAA
PSPRVMLETGCAGFRQMLDATLAAAGGIRIDHVLGLMRLWLIPDGASPAEGAYLRYPLAE
MLDVVADVSQRRRAVVIGEDLGTVPDGFRAVLAARGLMGTRVLWFERDGTDGFRAPEAWE
DGITATTTTHDLPTTAGWWQGLDIAWRERLSLFGPGETAALAQETRTRDRTRLWTAFTNA
GTATGPEPAPDTPAPVIDAALDFLGRSRAPLVLAPLEDLVGLDDQPNLPGTIHEHPNWRR
RMPAPLPGLVETPAVVRRVGRVKMGREKGVTRGR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggccctggccgccgccgccggcatcgccaccagctggaccgatgccgcgggccag
ggacacagtgtgacccccgacacgctgcgcgcgctgctggcggtgctggacctgccggcc
gacagcccggcacagatccgcgagagcctggagcgggcggccgctttgccgccgccgcgg
ccggatgcggcaatgggcccgcgctgcttcggcctggacgcggccctgggccagcccggc
cggcctccgcgggcctggggggcgacggcgcagctttacgggctgcggcgatcgggcgat
ccgggctgcggcgataccaccgcgctggccgggctcgcccgcagcctgggcaaagccggg
gcctgctgcctgggggtgagcccggtccatgccctgttcggcgccgatccgcatcgctgg
agcccttatgccccgtccagccggctgttcctgaacgagctgatcatcgaccccgacgac
atcgccggccccgcggagaccgcgcgggcgctggagacgctggggcttgcggcgcgcgcc
cgtgccgccgcggcggcgccgctggtggactggcccgaggtggcggcggtcaaacgggcg
gtgatcgaccatctgctgaaggcccatggcgcccggcttgccgccgatgccgactggcag
gccttccgggccgcacgcggccgcgcgctggacgatcatgcggtcttcgaggtgctggat
gcccggtttcgggagcaggggctgaccggcggatggccatcctggccacaagactttcgc
gatccacatggctcatctgtggccaatatggccaaaagcgcggcggaggcggtggatcgg
gcgcggctgcggcaatggctcgccttccgcggcctggccggggcgcagagggcggccacc
gatgccgggatgggggtggggctgatcgccgacctcgccatcggtgtcgacggcagcggc
gcgcagtcgtggagcgagcgcgccggcgatctgaacggggcgggtatcctgaccggggcg
agcatcggcgcgccgcccgatctgttcaacccgctgggccagaactgggggctggcggcg
ccgtcgccgcgggtgatgctggaaaccggttgcgccggcttccgccagatgctggacgcg
accctcgccgccgccggcggcatccgcatcgaccatgttctggggctgatgcggctctgg
ctgatccccgacggcgcgtcaccggccgaaggcgcctatctgcgctatccgctggcggag
atgctggatgtggtggcggatgtctcgcagcgccgccgggcggtggtgatcggcgaggat
ctgggcacggtgcccgacggcttccgcgcggtgctggccgcccgcgggttgatgggcacc
cgggtgctgtggttcgaacgcgacgggacggacggtttccgcgccccggaggcctgggag
gacggcatcaccgccaccaccaccacccacgacctgccgaccaccgccggctggtggcag
gggctcgacatcgcctggcgcgagcgcctctcgctgttcgggcccggtgagaccgcggca
ctggcgcaggagacccgcacccgcgaccgcacccggctctggaccgccttcaccaatgcc
ggcaccgccaccggccccgaacccgcccccgacacgcccgccccggtgatcgacgcggcc
ctcgacttcctgggccgcagccgcgcccccctggtgctggccccgctggaagacctggtc
gggctggacgaccagcccaacctgcccggcaccatccacgaacaccccaactggcgccgc
cgcatgccggcccccctgccggggctggtggagacgccggcggtggtgcggcgggtgggg
cgggtgaagatggggcgggagaagggggtgacccggggtcgatga

DBGET integrated database retrieval system