KEGG   Tistrella mobilis: TMO_a0213Help
Entry
TMO_a0213         CDS       T02128                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tmo  Tistrella mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tmo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM1:complement(238567..240732)
Genome map
AA seq 721 aa AA seqDB search
MLGPGPILGPVPISGPGRRRLVVIRPDADEVGAAAQQDGRPLGILARVHPAGIFAGTIED
APYRLVVTTGRGTETVEDPYRFGPILTDEDLQLIRTGRHPDLPGVLGARATEIDGVAGTV
FAVWAPNADRVSVTGDFNGWDGRRHPMRLRHTAGVWELFLPGIGPGRAYRYEIRSRGGAV
LHKADPMAQATEMPPGTASIVPDPTPFPWTDGSWMARRATTDLLKMPVSVYEVHAASWFR
DAAHPQLDWDGLADRLIPYVRALGFTHVELLPVMEHPFGGSWGYQPLGLFAPSARFGRPR
GFARFVDRCHAAGIGVILDWVPAHFPMDSHGLFRFDGTALYEHEDPREGIHRDWNTAIYN
HGRDEVAGFLIASALYWLEHYHVDALRVDAVASMLYRDYSREAGDWVPNIHGGRENLETV
AFLRRLNQVIEARVPGAMTIAEESTAWPGVTAPVAAEGSETALGFTLKWNMGWMHDSLKY
MGEDPINRRWHHGTMTFSLVYAWSERYVLPLSHDEVVHGKGSLLGRMPGDDWQKRANLRA
YLAFMWGHPGRKLIFAGGELGNPREWDHDGSTPWGLLDDPGHQGIQALVADLNRLYAHEP
ALHARDDDPGGFQWVVGDDAANSVFAWIRRTGEEATEPAPPSSGMLVVANLTPVPREGYR
IGVPAPGIWHEVLNTDATAYGGSGLGNGGRALAVETPAHGRPASLTLTLPPLSTLMLRQG
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggtcccggccccatcctgggaccggttcccatctccggaccgggccggcgccgg
ctggtggtgatccgccccgatgccgacgaggtgggggcagcggcgcaacaggatggccgg
ccgctgggcatcctggcccgggtgcatccggccgggatcttcgccggcacgatcgaggat
gccccctaccggctggtggtgaccaccggccggggcacggaaacggtggaagatccctat
cgcttcggcccgatcctgaccgacgaggatctgcagctgatccgcaccggccgccatccc
gacctgccgggggtgctgggtgcgcgggcaacggagatcgacggcgtcgccggcaccgtg
ttcgcggtctgggcacccaatgccgaccgggtctcggtgaccggcgatttcaacggctgg
gacgggcgccgccacccgatgcggctacgccatacggccggcgtctgggagctgttcctg
cccggcatcggcccgggccgggcctatcgctacgagatccgcagccgcggcggcgccgtg
ctgcacaaggccgacccgatggcccaggcgacggaaatgccgcccggcaccgccagcatc
gtgcccgacccgacccccttcccctggaccgacggcagctggatggcccggcgcgccacc
accgatctgctgaagatgccggtctcggtctacgaggtccatgcggcgtcgtggttccgc
gatgccgcccacccgcagctggactgggacgggctggccgaccggctgatcccctatgtc
cgggcgctgggcttcacccatgtcgagctgctgccggtgatggagcaccccttcggcgga
tcctggggctatcagccgctggggctgttcgcccccagcgcccgtttcggccggccgcgc
ggcttcgcgcgcttcgtggaccgctgccacgccgccgggatcggggtgatcctggactgg
gtgccggcgcatttcccgatggacagccacgggctgttccgcttcgacggcacggcgctt
tacgagcatgaagacccgcgcgagggcattcatcgcgactggaacaccgccatctacaat
cacggccgcgacgaggtagccggcttcctgatcgcgagcgcgctctattggctggagcat
taccatgtcgatgcactgcgggtggatgccgtggcctcgatgctctatcgcgactacagc
cgcgaggccggcgactgggtgcccaacatccatggcggccgcgagaacctggaaacggtg
gcctttctgcgccggctgaaccaggtgatcgaggcgcgcgtgccgggcgccatgaccatc
gccgaggaatccaccgcctggccgggggtgacggcgccggtcgcggccgaaggatcggag
accgcgctgggcttcacgctcaaatggaatatgggctggatgcacgacagcctgaaatat
atgggcgaggacccgatcaaccggcgctggcatcacggcaccatgaccttcagcctggtc
tatgcctggtcggaacgctatgtgctgccgctgtcgcatgacgaggtggtccacggcaag
ggctcgctgctcggccgcatgccgggggatgactggcagaaacgcgccaatctgcgcgcc
tatctcgccttcatgtggggccatcccggccgcaagctgatctttgccggcggcgaactg
ggcaacccgcgcgaatgggaccatgacggctccaccccctgggggctgctcgacgatccc
ggccatcagggcatccaggcgctggtcgccgatctgaaccggctctacgcccacgagccg
gcgctgcacgcccgcgacgacgacccgggcggctttcagtgggtggtgggcgacgatgcc
gccaacagcgtcttcgcctggatccgccgcacgggggaagaggcgaccgagcccgccccc
ccgtcctctggcatgcttgtggtcgccaatctgaccccggtcccgcgcgagggctatcgt
atcggggttccggcccccggcatctggcacgaggtgctgaacaccgacgccaccgcctat
ggcggttcgggcctgggcaatggcggccgggcgctggcggtggaaaccccggcgcatggc
cggcccgcctctctcaccctgacgctgccgccgctttccacactgatgttgagacaggga
aggtag

DBGET integrated database retrieval system