KEGG   Tistrella mobilis: TMO_a0213Help
Entry
TMO_a0213         CDS       T02128                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tmo  Tistrella mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TMO_a0213
Enzymes [BR:tmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TMO_a0213
Exosome [BR:tmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TMO_a0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM1:complement(238567..240732)
Genome map
AA seq 721 aa AA seqDB search
MLGPGPILGPVPISGPGRRRLVVIRPDADEVGAAAQQDGRPLGILARVHPAGIFAGTIED
APYRLVVTTGRGTETVEDPYRFGPILTDEDLQLIRTGRHPDLPGVLGARATEIDGVAGTV
FAVWAPNADRVSVTGDFNGWDGRRHPMRLRHTAGVWELFLPGIGPGRAYRYEIRSRGGAV
LHKADPMAQATEMPPGTASIVPDPTPFPWTDGSWMARRATTDLLKMPVSVYEVHAASWFR
DAAHPQLDWDGLADRLIPYVRALGFTHVELLPVMEHPFGGSWGYQPLGLFAPSARFGRPR
GFARFVDRCHAAGIGVILDWVPAHFPMDSHGLFRFDGTALYEHEDPREGIHRDWNTAIYN
HGRDEVAGFLIASALYWLEHYHVDALRVDAVASMLYRDYSREAGDWVPNIHGGRENLETV
AFLRRLNQVIEARVPGAMTIAEESTAWPGVTAPVAAEGSETALGFTLKWNMGWMHDSLKY
MGEDPINRRWHHGTMTFSLVYAWSERYVLPLSHDEVVHGKGSLLGRMPGDDWQKRANLRA
YLAFMWGHPGRKLIFAGGELGNPREWDHDGSTPWGLLDDPGHQGIQALVADLNRLYAHEP
ALHARDDDPGGFQWVVGDDAANSVFAWIRRTGEEATEPAPPSSGMLVVANLTPVPREGYR
IGVPAPGIWHEVLNTDATAYGGSGLGNGGRALAVETPAHGRPASLTLTLPPLSTLMLRQG
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggtcccggccccatcctgggaccggttcccatctccggaccgggccggcgccgg
ctggtggtgatccgccccgatgccgacgaggtgggggcagcggcgcaacaggatggccgg
ccgctgggcatcctggcccgggtgcatccggccgggatcttcgccggcacgatcgaggat
gccccctaccggctggtggtgaccaccggccggggcacggaaacggtggaagatccctat
cgcttcggcccgatcctgaccgacgaggatctgcagctgatccgcaccggccgccatccc
gacctgccgggggtgctgggtgcgcgggcaacggagatcgacggcgtcgccggcaccgtg
ttcgcggtctgggcacccaatgccgaccgggtctcggtgaccggcgatttcaacggctgg
gacgggcgccgccacccgatgcggctacgccatacggccggcgtctgggagctgttcctg
cccggcatcggcccgggccgggcctatcgctacgagatccgcagccgcggcggcgccgtg
ctgcacaaggccgacccgatggcccaggcgacggaaatgccgcccggcaccgccagcatc
gtgcccgacccgacccccttcccctggaccgacggcagctggatggcccggcgcgccacc
accgatctgctgaagatgccggtctcggtctacgaggtccatgcggcgtcgtggttccgc
gatgccgcccacccgcagctggactgggacgggctggccgaccggctgatcccctatgtc
cgggcgctgggcttcacccatgtcgagctgctgccggtgatggagcaccccttcggcgga
tcctggggctatcagccgctggggctgttcgcccccagcgcccgtttcggccggccgcgc
ggcttcgcgcgcttcgtggaccgctgccacgccgccgggatcggggtgatcctggactgg
gtgccggcgcatttcccgatggacagccacgggctgttccgcttcgacggcacggcgctt
tacgagcatgaagacccgcgcgagggcattcatcgcgactggaacaccgccatctacaat
cacggccgcgacgaggtagccggcttcctgatcgcgagcgcgctctattggctggagcat
taccatgtcgatgcactgcgggtggatgccgtggcctcgatgctctatcgcgactacagc
cgcgaggccggcgactgggtgcccaacatccatggcggccgcgagaacctggaaacggtg
gcctttctgcgccggctgaaccaggtgatcgaggcgcgcgtgccgggcgccatgaccatc
gccgaggaatccaccgcctggccgggggtgacggcgccggtcgcggccgaaggatcggag
accgcgctgggcttcacgctcaaatggaatatgggctggatgcacgacagcctgaaatat
atgggcgaggacccgatcaaccggcgctggcatcacggcaccatgaccttcagcctggtc
tatgcctggtcggaacgctatgtgctgccgctgtcgcatgacgaggtggtccacggcaag
ggctcgctgctcggccgcatgccgggggatgactggcagaaacgcgccaatctgcgcgcc
tatctcgccttcatgtggggccatcccggccgcaagctgatctttgccggcggcgaactg
ggcaacccgcgcgaatgggaccatgacggctccaccccctgggggctgctcgacgatccc
ggccatcagggcatccaggcgctggtcgccgatctgaaccggctctacgcccacgagccg
gcgctgcacgcccgcgacgacgacccgggcggctttcagtgggtggtgggcgacgatgcc
gccaacagcgtcttcgcctggatccgccgcacgggggaagaggcgaccgagcccgccccc
ccgtcctctggcatgcttgtggtcgccaatctgaccccggtcccgcgcgagggctatcgt
atcggggttccggcccccggcatctggcacgaggtgctgaacaccgacgccaccgcctat
ggcggttcgggcctgggcaatggcggccgggcgctggcggtggaaaccccggcgcatggc
cggcccgcctctctcaccctgacgctgccgccgctttccacactgatgttgagacaggga
aggtag

DBGET integrated database retrieval system