KEGG   Tistrella mobilis: TMO_a0524Help
Entry
TMO_a0524         CDS       T02128                                 

Definition
(GenBank) acetyl-CoA synthetase/AMP-(fatty) acid ligase FadDx
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tmo  Tistrella mobilis
Pathway
tmo00010  Glycolysis / Gluconeogenesis
tmo00620  Pyruvate metabolism
tmo00640  Propanoate metabolism
tmo00680  Methane metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_a0524
   00620 Pyruvate metabolism
    TMO_a0524
   00640 Propanoate metabolism
    TMO_a0524
  Energy metabolism
   00680 Methane metabolism
    TMO_a0524
Enzymes [BR:tmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TMO_a0524
Lipid biosynthesis proteins [BR:tmo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TMO_a0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFK55927
UniProt: I3TT39
Position
pTM1:complement(585964..587610)
Genome map
AA seq 548 aa AA seqDB search
MTQSWADAAAGFDFEAMLRQSLAGDLAAMNACVECCDAHAAADPDRIALRYESRDGHGGT
MTFGALKEAAGRFANLLAARGIGPGDRVGGLLPRVPELLVTILGTWRAGAVYQPLFTAFG
PKAIEHRTATAGTKLIVTDAQNRDKLNELSVPATIAVIRGGAGAGDLDFEAELAAQSPDF
APIMRRGEDPFLIMFTSGTTGPAKPVMVPLRAIAAFKGYMQLAVGLRADDVFWNIADPGW
AYGLYYAVTGPLSLGVATTFYDGPFTAESTYGLIGKLGVTNLAGAPTAYRLLLAAGPELA
EGVKGRLRAVSSAGEPLNPEVIRWFAEHLGTVIHDHYGQTELGMVLCNHHDLDHPVQAGA
AGFAVPGHRIVVVDEDTLEELPVGQPGILAVDREASPQFWFQGYWNMPTKSLRGRYYLSG
DTVELNEDGSISFVGRSDDVITSSGYRIGPFDVESALIEHKAVVETAVVGKPDPERTEIV
KAFVVLKPAYEPTPELAEELRRHVRARLSAHAYPREIEFVDELPKTPSGKLQRFILRNQE
KAKAEAGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcctgggccgatgcggctgcgggcttcgatttcgaagcgatgctgcgccag
tcgctggccggcgatcttgccgcgatgaatgcctgcgtggagtgctgcgacgcccatgcc
gccgccgatcccgaccggatcgcactgcgctatgaaagccgcgacggccatggcggcaca
atgaccttcggcgcgttgaaagaagcggccggccgcttcgccaatctgctggccgcccgc
ggcatcggtcccggcgaccgggtcggcgggctgctgccgcgggtgccggaactgctggtc
accatcctgggcacctggcgggcgggcgcggtctatcagccgctgttcaccgccttcggc
cccaaggcgatcgagcatcgcacggccaccgccggcacgaagctgatcgtgaccgacgcc
cagaaccgcgacaagctgaacgagctgagcgtgccggcgaccatcgccgtcatccgcggc
ggtgccggtgccggcgatctggatttcgaggccgaactcgccgcgcagagcccggatttc
gcgccgatcatgcgccgcggcgaagatccgttcctgatcatgttcacctcgggcaccacc
ggcccggccaagccggtgatggtgccgctgcgcgcaatcgccgccttcaagggctatatg
cagctggcggtggggctgcgcgccgacgacgtgttctggaacatcgccgatccgggctgg
gcctatggcctgtattacgcggtcaccggcccgctgtcgctcggcgtcgccaccactttc
tatgacgggccgttcacggccgagagcacctatggtctgatcgggaagctgggcgtcacc
aatctggcgggtgccccaaccgcctatcgcctgcttctggccgccggccccgaactggcg
gaaggcgtgaagggccggctgcgcgcggtctccagcgccggcgagccgctgaaccccgag
gtgatccgctggttcgccgaacatctggggacggtgatccacgatcattacggccagacc
gaactcggcatggtgctgtgcaaccatcatgacctggaccatccggttcaggccggcgcc
gcgggcttcgccgtgcccggccaccgcatcgtggtggtggatgaagacacgctggaagaa
ctgcccgtgggtcagcccggcatcctggcggtggatcgcgaggcctcgccgcaattctgg
ttccagggctactggaacatgccgacgaagtcgctgcgcggccgctattacctgtcgggc
gacacggtggagctgaacgaggacggcagcatctccttcgtcggccggtcggacgacgtc
atcacctcgtcgggctatcgcatcgggcccttcgatgtggaaagcgcgctgatcgagcac
aaggcggtggtggagaccgccgtggtcggcaagcccgaccccgagcgtaccgagatcgtg
aaggccttcgtggtgctgaagccggcttatgagcccacgcccgagctggcggaggaattg
cgccgccatgtccgcgcccggctgtcggcccatgcctatccgcgtgagatcgaattcgtc
gacgaactgcccaagacgccgagcggcaagctgcagcgcttcatcctgcgcaaccaggaa
aaggcgaaagcagaagccggcgcctga

DBGET integrated database retrieval system