KEGG   Tistrella mobilis: TMO_b0122Help
Entry
TMO_b0122         CDS       T02128                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tmo  Tistrella mobilis
Pathway
tmo00360  Phenylalanine metabolism
tmo00362  Benzoate degradation
tmo00620  Pyruvate metabolism
tmo00621  Dioxin degradation
tmo00622  Xylene degradation
tmo00650  Butanoate metabolism
tmo01100  Metabolic pathways
tmo01120  Microbial metabolism in diverse environments
tmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TMO_b0122
   00650 Butanoate metabolism
    TMO_b0122
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TMO_b0122
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TMO_b0122
   00622 Xylene degradation
    TMO_b0122
   00621 Dioxin degradation
    TMO_b0122
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TMO_b0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFK56130
UniProt: I3TTP2
Position
pTM2:127985..128923
Genome map
AA seq 312 aa AA seqDB search
MTKVKCAIIGSGNIGTDLMIKIMRMSKTLEMAAMVGIDPESDGLKRAARLGVATTHDGVE
GLQALPVYPEIGIVFDATSAGAHARHDRLLQADGKQVIDLTPAAIGPYVVPPVNLDAMRD
APNVNMVTCGGQATIPIVAAVASVAPVTYAEIVASISSRSAGPGTRANIDEFTETTSRAI
REVGGAGAGKAIIVLNPAEPPLIMRDTVYCLAQTQDREAVRIAIEKMVAEVQAYVPGYRL
KQAVQFEVIGDNAPLRIPGVAEAATGLKVSVFLEVEGAGHYLPAYAGNLDIMTSAALKTA
ERLVDLRREKAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggtcaaatgcgccatcatcggctcgggcaatatcggcaccgatctgatgatc
aagatcatgcgcatgtcgaagacgctggagatggcggccatggtcggcatcgatcccgag
agcgacgggctgaagcgggccgcacggctgggcgtcgccaccacccatgacggcgtcgag
gggctgcaggccctgccggtctatcctgagatcggcatcgtgttcgacgccacctcggcc
ggcgcccatgcccggcacgaccggttgcttcaggccgacggcaagcaggtgatcgacctc
accccagccgccatcggcccctatgtggtgccgccggtcaatctggatgccatgcgcgac
gcccccaatgtcaacatggtcacctgcggcggccaggccaccatcccgatcgtggcggcg
gtggcgagcgttgcaccggtgacctatgccgagatcgtggcctcgatttcctcgcgctcg
gccggccccggcacccgcgccaatatcgacgaattcaccgagaccacctcgcgtgccatc
cgcgaggtcggcggcgccggtgccggcaaggcgatcatcgtgctgaacccggctgagccg
ccgctgatcatgcgcgacacggtctattgcctggcgcagacccaggaccgcgaggcggtc
cgcatcgccatcgagaagatggtggccgaggttcaggcctatgtccccggctaccggctg
aagcaggcggtgcagttcgaggtgatcggcgacaacgccccgctccgcatccccggcgtt
gccgaagcggccaccggcctcaaggtcagcgtcttcctggaggtcgagggcgccggccat
tacctgccggcctatgccggcaatctcgacatcatgacctcggcggcgctgaagaccgcc
gaacgcctggtcgacctgcggcgcgagaaggcagcctga

DBGET integrated database retrieval system