KEGG   Tistrella mobilis: TMO_b0348Help
Entry
TMO_b0348         CDS       T02128                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tmo  Tistrella mobilis
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:tmo00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM2:complement(406830..407744)
Genome map
AA seq 304 aa AA seqDB search
MTSTRRAFRDRVSGAHNAMPAHTTPAHTTPARIMAAHNPLSARLVEEAGFDGAWASGFEI
SAALGLPDISLVSMAEHLEVVRAMAARTRLPVVADIDTGFGNALNVLHAVRSYEAAGAAA
VVIEDKVFPKVTSLVEGGRQDLLRIAEFQGKIEAARHARNDPDFLIIARTEALIAGAGPG
AALERGRAYAAAGADLLLVHSKSTTPDEIEGFIAAWDGGIPIVIVPTAYPQMTMARAAAS
GRVGLVIYGNHAIRAAVAAMQQSFARIMADGDTLGVEGGIAPVGEIFRLQGMDQVARDEA
AFLR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgacccgacgggccttccgcgaccgcgtttccggcgcccacaatgccatgccc
gcccacaccacgcccgcccacaccacgcccgcccgcatcatggccgcccacaacccgctt
tcggcgcggctggtggaagaggcgggcttcgacggcgcctgggccagcggttttgaaatc
tcggcggcgctcggcctgcccgatatcagcctggtctcgatggccgagcatctggaggtc
gtacgcgcgatggcggcccgcacccgcctgccggtggtggccgatatcgacaccggtttc
ggcaatgccctcaacgtcctgcatgccgtgcgcagctacgaggcggcgggtgccgccgcg
gtggtgatcgaggacaaggtctttcccaaggtcacctcgctggtcgagggcgggcgtcag
gacctgctccggatcgccgagtttcagggcaagatcgaggccgcccgccacgcccggaac
gacccggatttcctgatcatcgcccgtaccgaggcgctgatcgccggcgccgggccgggt
gcggcgctggagcgcggccgcgcctatgccgccgccggggcggatctgctgctggtccat
tcgaagtcgaccacccccgacgagatcgagggcttcatcgccgcctgggatggcggcatc
ccgatcgtcatcgtccccaccgcctatccgcagatgaccatggcgcgcgccgcggcaagc
ggccgggtcggcctggtgatctatggcaaccatgcgatccgggccgcggtcgccgccatg
cagcagagcttcgcccggatcatggccgatggcgacacgctgggcgtcgagggcggcatc
gccccggtcggcgaaatcttccgcctgcagggcatggatcaggtggcgcgcgacgaggcg
gcatttctgcgctga

DBGET integrated database retrieval system