KEGG   Tistrella mobilis: TMO_b0354Help
Entry
TMO_b0354         CDS       T02128                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tmo  Tistrella mobilis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TMO_b0354
Enzymes [BR:tmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TMO_b0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM2:414043..414819
Genome map
AA seq 258 aa AA seqDB search
MTNPSAPHQTLRDKAYFDRRATDEMARHLAPAGRSLHETMATSCRILAMTGQEAGLAGQI
SVRSDRPGAYWTLRFGLGFDEATPADFIEVDRDLNTLSGEGMANPATRFHLWVYDARPDV
NAIIHTHSPWAAALAAARQPLVIAQMDMTPLHDDCAFLADWPGVPIADQEGVIISEALGT
KRAIILAHHGYLTAGGSCEEATYLAVYLERAARMQLRAQAAFGPLTPVDPTLGAEAHDYL
LKPVIVNATFDYWARQAG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacccgtccgccccacaccagacgctgcgcgacaaggcgtatttcgaccgccgc
gccaccgacgagatggcccgacatctggcccctgccggccgcagcctgcacgagaccatg
gccacttcctgccggattctggcgatgaccggccaggaggccgggctggccgggcagatc
agtgtgcgatccgaccgacccggcgcctattggacgctgcgcttcggcctgggcttcgac
gaggcgacgcccgccgatttcatcgaggtcgaccgcgacctgaacacgctttcgggcgag
ggcatggccaaccccgccacccgctttcatctctgggtctatgatgcccgtccggatgtg
aatgcgatcatccacacccactcgccctgggccgcagcccttgccgcggcccgccagccg
ctggtgatcgcgcagatggacatgaccccgctgcacgacgactgcgccttcctggccgac
tggccgggcgtgccgatcgccgatcaggaaggcgtgatcatttcggaagcgctggggacg
aaacgggcgatcatcctggcccatcacggctatctgaccgcaggcggcagctgcgaggaa
gcgacctatctggcggtctatctggaacgggccgcccggatgcagctgcgcgcccaggcg
gccttcggtccgctgacgccggtcgacccgacgcttggcgccgaggcgcacgactatctg
ctgaaacccgtcatcgtcaacgcgaccttcgattattgggcccggcaggccggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system