KEGG   Tistrella mobilis: TMO_b0354Help
Entry
TMO_b0354         CDS       T02128                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tmo  Tistrella mobilis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tmo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM2:414043..414819
Genome map
AA seq 258 aa AA seqDB search
MTNPSAPHQTLRDKAYFDRRATDEMARHLAPAGRSLHETMATSCRILAMTGQEAGLAGQI
SVRSDRPGAYWTLRFGLGFDEATPADFIEVDRDLNTLSGEGMANPATRFHLWVYDARPDV
NAIIHTHSPWAAALAAARQPLVIAQMDMTPLHDDCAFLADWPGVPIADQEGVIISEALGT
KRAIILAHHGYLTAGGSCEEATYLAVYLERAARMQLRAQAAFGPLTPVDPTLGAEAHDYL
LKPVIVNATFDYWARQAG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacccgtccgccccacaccagacgctgcgcgacaaggcgtatttcgaccgccgc
gccaccgacgagatggcccgacatctggcccctgccggccgcagcctgcacgagaccatg
gccacttcctgccggattctggcgatgaccggccaggaggccgggctggccgggcagatc
agtgtgcgatccgaccgacccggcgcctattggacgctgcgcttcggcctgggcttcgac
gaggcgacgcccgccgatttcatcgaggtcgaccgcgacctgaacacgctttcgggcgag
ggcatggccaaccccgccacccgctttcatctctgggtctatgatgcccgtccggatgtg
aatgcgatcatccacacccactcgccctgggccgcagcccttgccgcggcccgccagccg
ctggtgatcgcgcagatggacatgaccccgctgcacgacgactgcgccttcctggccgac
tggccgggcgtgccgatcgccgatcaggaaggcgtgatcatttcggaagcgctggggacg
aaacgggcgatcatcctggcccatcacggctatctgaccgcaggcggcagctgcgaggaa
gcgacctatctggcggtctatctggaacgggccgcccggatgcagctgcgcgcccaggcg
gccttcggtccgctgacgccggtcgacccgacgcttggcgccgaggcgcacgactatctg
ctgaaacccgtcatcgtcaacgcgaccttcgattattgggcccggcaggccggctag

DBGET integrated database retrieval system