KEGG   Tistrella mobilis: TMO_c0246Help
Entry
TMO_c0246         CDS       T02128                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tmo  Tistrella mobilis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tmo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tmo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM3:complement(265474..266946)
Genome map
AA seq 490 aa AA seqDB search
MRLIELIDRDATAIGGDTRITGITADSRAVRPGMLFAAVPGTVRDGRDFIPEAVAAGAVA
VLAPTGTVVPAGVALVETPEVRGALARMASRFYPKRPGVIAAVTGTNGKSSVVSFTRQIW
VRLGLAAASLGTLGYDGPGDLAAPGLTTVDPVALHRLLDQAARAGVGHLAMEASSHGLDQ
HRLDGIAPVAVAFTNLTHDHLDYHGTIEAYRDAKLKLFAEIAAPAGYAVINADSSHYDHF
VRAALKRPLAVIDYGRKARVLRLVSVEPMTGGGLHVAIEYRGQRHEFGLGLTGSFQAHNV
LAAMGLAIGCGASPEAVVAALPYLKAVPGRMEQVGTSAAGAPVLVDYAHTPDALETVLKA
VRPHAHDRVVTVFGCGGDRDRTKRPAMGKIALREADHAIVTDDNPRSEDPAAIRAEILAA
GPGLVEIGDRAAAIDAAIAGLGAGDVLVIAGKGHETGQKIGDRVLPFDDREVARAALHAH
GGTVIGGGAA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttattgagctgatcgaccgcgatgcgaccgcgatcggcggtgatacccggatc
acgggcatcaccgccgacagccgcgccgtgcggccgggcatgctctttgccgccgttccg
ggcacggtgcgtgacggccgtgacttcattcccgaagccgtggcggcgggggccgtcgcg
gtgctcgcgcccacaggtacggtggtgccggcgggtgttgcactggtcgaaaccccggaa
gtgcgtggcgcgctggcgcggatggccagccgcttctatccgaagcggccgggcgtgatc
gcggctgtcacgggcaccaacggcaaaagctctgtggtctcgttcacccgccagatctgg
gtgcggctgggattggccgccgccagcctcggcacgctcggctatgacgggccgggcgat
ctggcggcgccggggctgaccacggtcgacccggtggccctgcatcgcctgctggatcag
gcggcgcgggccggggtggggcatctggcgatggaagcctccagccatgggctggatcag
caccggctggacgggatcgcgccggtcgcggtcgccttcaccaacctcactcatgatcat
ctggactatcacggcacgatcgaggcctatcgcgacgccaagctgaagctgttcgccgag
atcgcggcgccggccggctatgcggtgatcaatgccgacagcagccattacgaccatttt
gtccgcgcggcgctgaagcggccgctggcggtgatcgattacggccgcaaggcccgggtg
ctgcgcctggtctcggtggagccgatgaccggtggcggcctgcatgtggcgatcgaatat
cgcggccagcgccacgaattcggcttggggctgaccggcagcttccaggcgcacaacgtg
ctggccgccatggggctcgccatcggctgcggcgcatcgcccgaggcggtggtggcggcg
ctgccttatctgaaggcggtgcccggccggatggagcaggtcggcaccagcgccgccggc
gcgccggttctggtcgactatgcccatacccccgatgcgctggagacggtgctgaaggcg
gtgcgcccccatgcccacgaccgggtggtgacggtgttcggctgcggcggcgatcgcgac
cgcaccaagcggccggcgatggggaagatcgcactgcgcgaggccgaccacgccatcgtc
accgacgacaatccgcgcagcgaggacccggccgcgatccgcgccgagattctggcggcc
ggtcccggcctggtcgagatcggcgaccgggcggcggcgatcgatgccgcgattgccggc
cttggggccggcgacgtgctggtgatcgccggcaagggccacgagaccggccagaagatc
ggcgaccgggtgctgcccttcgacgatcgcgaggtcgcgcgcgcggcgcttcatgctcat
ggtgggaccgtgatcgggggaggggcggcatga

DBGET integrated database retrieval system