KEGG   Tistrella mobilis: TMO_c0549Help
Entry
TMO_c0549         CDS       T02128                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tmo  Tistrella mobilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TMO_c0549
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TMO_c0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM3:complement(603910..605247)
Genome map
AA seq 445 aa AA seqDB search
MRVIIVGGGIAGLGAAWRLRAEGHQVVLLEKAAEPGGRCRSVFWQGAWVPTGAFAFLGAE
TNLADLSRELGLHAPEDLLDLTAAHRWNVLIRRREVADFGAFDMMSAARHPAIPFAEKAR
LLVALPQLARRMLAADPRDLTSVVALDDVNACEHFRRLSPAFVDYFLEPCMGMFCGYGAE
DFSLAWTAWSSAGRLSWAGNHMWSYRERGVGRLTWALGRAFAADPGTDYRTGCTVHEVRH
DADGVQVAYSRADEAPEVIRADAVIMAVPGHLVSGLMPDLDAGRRGFFEAIDYAGHHIVY
YLLDRPKGDLLDTYVLPAADGFHRTGNMRFTDRGDGTTLAHAQWKDAGCRQHADATDDDL
IAITWGDMVEAVPGLAGTRLIDAFVSRQPAAICKRPKGFVTRLKAFRDLGPLPRVAFCGD
YLTNSTVGQAHWSGLQAAAEIMARG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcatcatcgtgggcgggggcattgccgggttgggtgcggcctggcggttgagg
gccgaggggcaccaggtggtgctgcttgaaaaggcggccgagccgggcgggcgctgccgg
tcggtgttctggcagggcgcctgggttccgaccggggccttcgcctttctgggcgccgag
accaatctcgccgatctgtcgcgtgaactggggctgcatgcaccggaagacctgctggac
ctgacggccgcccatcgctggaacgtactgatccgccgccgcgaggtggcggatttcggc
gccttcgacatgatgagcgccgcccggcatccggcgatcccctttgccgagaaggcccgg
ctgttggtggccctgccgcagctggcccggcggatgctggcggccgatccgcgcgacctg
accagcgtggtggccctggacgacgtcaatgcctgcgagcatttccggcgtctctcacct
gccttcgtcgactatttcctcgaaccctgcatgggcatgttctgcggctatggcgctgag
gatttctccctggcctggacggcctggagttcggccgggcggctgtcctgggccggcaac
catatgtggagctatcgcgagcgtggcgtcggccggttgacctgggcgttgggccgggcc
tttgcggccgatcccggcaccgactatcgcaccggctgcaccgtgcacgaggtgcgccat
gatgcggacggcgtgcaggttgcgtacagccgggcggacgaggcgccggaggtcatccgc
gccgatgccgtgatcatggcggtgcccggccatctggtctccgggctgatgccggatctg
gatgccgggcggcgcggcttcttcgaggcgatcgactatgccggccaccacatcgtctat
tacctgctggaccggcccaagggcgatctgctcgacacctatgttctgccggcggccgac
ggcttccatcgcaccggcaatatgcgcttcaccgatcgcggcgacggcaccaccctggcg
catgcccagtggaaggatgccggctgccggcagcatgccgatgccaccgatgacgacctg
atcgcgatcacctggggcgatatggtcgaggcggtgccggggctggccggcacgcggctg
atcgatgccttcgtttcgcgccagccggccgcgatctgcaagcggcccaagggcttcgtg
acccggctcaaggccttccgggatctgggaccgctgccgcgggtggcgttctgcggcgac
tatctgaccaacagcaccgtcggccaggcccactggtcggggctgcaggcggcggcggag
atcatggcgcgcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system