KEGG   Tistrella mobilis: TMO_c0803Help
Entry
TMO_c0803         CDS       T02128                                 

Definition
(GenBank) fatty-acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
tmo  Tistrella mobilis
Pathway
tmo01040  Biosynthesis of unsaturated fatty acids
tmo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TMO_c0803
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TMO_c0803
Lipid biosynthesis proteins [BR:tmo01004]
 Desaturase
  First
   TMO_c0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AFK57413
UniProt: I3TXC5
Position
pTM3:955953..956948
Genome map
AA seq 331 aa AA seqDB search
MMSSDTPTGGSTRPGGGSGLDPRLRRAQARHAFAILVLPAIGSLIAIGIAVHDGGVPAAA
LVILLVSYMATYAGITVGLHRLFAHRAFETTPWLRAVFAVLGCMAAQGPAIYWAANHRVH
HIRSDRDGDPHSPRIANGRQLGRWEGFWHAQAGWTFSHRPADVFAVTRDLTRDRRLMWIN
QRYLWWVALGLILPALAGALAIGGIRGAVLGLLWGGAVRLTLSYHFTNAINSLTHMIGTR
PFGGRNTSTNLWPIALPTLGEAWHNNHHAFPTSARFGLAVWEVDIGWWIIRSLEAVGLAW
NVRRPLPESISAKRAAAAAGMQVDDDDRVTA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtctgacacgccgaccggcggatcgacccgccccggaggggggagcggtctg
gatccgcgtctcagacgggcacaggcccgtcacgcctttgcgattctggtgctgcccgcc
atcggcagcctgatcgccatcggcatcgccgtccatgacggtggcgtcccggccgcggcc
ctggtgattctgctcgtgtcctatatggccacctatgccggcatcaccgtcgggctgcac
cggctgttcgcccatcgcgccttcgagaccacgccctggctgcgcgcggtgttcgccgtg
ctcggctgcatggcggcccagggaccggcgatctattgggccgccaatcatcgggtccat
cacatccggtcggaccgtgacggcgacccgcacagtccgcggatcgcgaacgggcggcag
ctgggacgctgggaagggttctggcacgcgcaggccggctggaccttcagccatcgcccg
gccgatgtcttcgccgtgacccgcgacctgacccgcgatcggcggctgatgtggatcaac
cagcgctatctgtggtgggtggccctggggctgatcctgccggcgctcgccggtgcgctc
gccatcggcggcatccggggcgcggtgttgggcctgctatggggcggcgcggtgcggctg
accctcagctatcacttcaccaatgcgatcaattcgctcacccacatgatcggcacccgg
cccttcggcggccggaatacatccaccaatctctggccgatcgccctgccgaccctgggt
gaggcctggcacaacaaccaccatgccttccccacctccgcccgcttcggcctggcggtc
tgggaggtggatatcggctggtggatcatccgcagcctggaagccgtggggcttgcctgg
aatgtccgccgccccctgcccgagagcataagcgccaagcgcgccgcagccgccgcgggc
atgcaggtcgacgacgacgaccgcgtgacggcctga

DBGET integrated database retrieval system