KEGG   Tistrella mobilis: TMO_c0803Help
Entry
TMO_c0803         CDS       T02128                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tmo  Tistrella mobilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TMO_c0803
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TMO_c0803
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TMO_c0803
Lipid biosynthesis proteins [BR:tmo01004]
 Desaturase
  First
   TMO_c0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM3:955953..956948
Genome map
AA seq 331 aa AA seqDB search
MMSSDTPTGGSTRPGGGSGLDPRLRRAQARHAFAILVLPAIGSLIAIGIAVHDGGVPAAA
LVILLVSYMATYAGITVGLHRLFAHRAFETTPWLRAVFAVLGCMAAQGPAIYWAANHRVH
HIRSDRDGDPHSPRIANGRQLGRWEGFWHAQAGWTFSHRPADVFAVTRDLTRDRRLMWIN
QRYLWWVALGLILPALAGALAIGGIRGAVLGLLWGGAVRLTLSYHFTNAINSLTHMIGTR
PFGGRNTSTNLWPIALPTLGEAWHNNHHAFPTSARFGLAVWEVDIGWWIIRSLEAVGLAW
NVRRPLPESISAKRAAAAAGMQVDDDDRVTA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtctgacacgccgaccggcggatcgacccgccccggaggggggagcggtctg
gatccgcgtctcagacgggcacaggcccgtcacgcctttgcgattctggtgctgcccgcc
atcggcagcctgatcgccatcggcatcgccgtccatgacggtggcgtcccggccgcggcc
ctggtgattctgctcgtgtcctatatggccacctatgccggcatcaccgtcgggctgcac
cggctgttcgcccatcgcgccttcgagaccacgccctggctgcgcgcggtgttcgccgtg
ctcggctgcatggcggcccagggaccggcgatctattgggccgccaatcatcgggtccat
cacatccggtcggaccgtgacggcgacccgcacagtccgcggatcgcgaacgggcggcag
ctgggacgctgggaagggttctggcacgcgcaggccggctggaccttcagccatcgcccg
gccgatgtcttcgccgtgacccgcgacctgacccgcgatcggcggctgatgtggatcaac
cagcgctatctgtggtgggtggccctggggctgatcctgccggcgctcgccggtgcgctc
gccatcggcggcatccggggcgcggtgttgggcctgctatggggcggcgcggtgcggctg
accctcagctatcacttcaccaatgcgatcaattcgctcacccacatgatcggcacccgg
cccttcggcggccggaatacatccaccaatctctggccgatcgccctgccgaccctgggt
gaggcctggcacaacaaccaccatgccttccccacctccgcccgcttcggcctggcggtc
tgggaggtggatatcggctggtggatcatccgcagcctggaagccgtggggcttgcctgg
aatgtccgccgccccctgcccgagagcataagcgccaagcgcgccgcagccgccgcgggc
atgcaggtcgacgacgacgaccgcgtgacggcctga

DBGET integrated database retrieval system