KEGG   Tistrella mobilis: TMO_c0833Help
Entry
TMO_c0833         CDS       T02128                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tmo  Tistrella mobilis
Pathway
tmo00071  Fatty acid degradation
tmo00280  Valine, leucine and isoleucine degradation
tmo00281  Geraniol degradation
tmo00310  Lysine degradation
tmo00360  Phenylalanine metabolism
tmo00362  Benzoate degradation
tmo00380  Tryptophan metabolism
tmo00410  beta-Alanine metabolism
tmo00627  Aminobenzoate degradation
tmo00640  Propanoate metabolism
tmo00650  Butanoate metabolism
tmo00903  Limonene and pinene degradation
tmo00930  Caprolactam degradation
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01212  Fatty acid metabolism
Module
tmo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TMO_c0833
   00650 Butanoate metabolism
    TMO_c0833
  Lipid metabolism
   00071 Fatty acid degradation
    TMO_c0833
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TMO_c0833
   00310 Lysine degradation
    TMO_c0833
   00360 Phenylalanine metabolism
    TMO_c0833
   00380 Tryptophan metabolism
    TMO_c0833
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TMO_c0833
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TMO_c0833
   00281 Geraniol degradation
    TMO_c0833
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TMO_c0833
   00627 Aminobenzoate degradation
    TMO_c0833
   00930 Caprolactam degradation
    TMO_c0833
Enzymes [BR:tmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TMO_c0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFK57443
UniProt: I3TXF5
Position
pTM3:complement(987369..988058)
Genome map
AA seq 229 aa AA seqDB search
METSFRDGVATVRFDDGKANALDAGWFTRLDAALDEVEAADARALVLAGRDGMFSAGLNL
KILPGLSGPEFIAFFEQFSRLVLRLHGLGLPTVAALTGHAIAGGAILAYACDMRCMTAGP
YRLQLNETAIGMPLPAWMLMVAQSVVPRHLEARALLHAEAFSAEAALAENLIDDIEVDPA
STVARAERMARDLAERLSPAAYAATKARLRGPLIRAALDGLAADLATLR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggagaccagcttccgggacggggtcgccaccgtccgcttcgacgacggcaaggccaat
gcgctcgacgccggttggttcacccggctggatgcggcgctggacgaggtcgaggcggcg
gacgcccgcgccctggtgctggcggggcgcgacggcatgttttcagccgggctgaacctc
aagatcctgccggggctgtcgggcccggagttcatcgccttcttcgagcagttctcgcgg
ctggtactgcggctgcacgggctgggcctgccgacggtcgcagcgctcaccggccatgcc
atcgccggcggcgcgatcctggcctatgcctgcgacatgcgctgcatgaccgccggccct
tatcggctgcaattgaacgagactgcgatcggcatgccgctgccggcctggatgctgatg
gtggcgcagagcgtggtgccgcggcatctggaggcgcgggcgctgctgcatgcggaagcc
ttctcggccgaggcggcgctggccgagaatctgatcgacgatatcgaggtcgaccccgcc
agcaccgtcgcccgggcggagcgcatggcccgggatctggccgagcgtctgtcgcccgcc
gcctatgccgcaaccaaggcgcggctgcgcggccccctgatccgcgcggcactggacggg
ctggcagccgatctggcgacgctgcgctga

DBGET integrated database retrieval system