KEGG   Tistrella mobilis: TMO_d0038Help
Entry
TMO_d0038         CDS       T02128                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tmo  Tistrella mobilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tmo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTM4:41326..42756
Genome map
AA seq 476 aa AA seqDB search
MMTILAIDQGTTTTRAVLVGPDGGTRIVASLPHRQIHPAPGHVEHDPEELIRNLRSCLDA
ARAAGAPLAVGIDNQGESCLAWDAATGEAISPVLVWQDDRTRDVVDRLRADGAEDMVLSR
AGLPLDPYFSASKLAWILREIPAARRLAGLGRLRLGTTDAFFRDRLTGRFETDVTTASRT
ALMNLDSCDWDPELCRLFGVPIEALPPIGPSTGDFGTLAGTGLRLTASLVDQQASLYGHG
CRQAGDGKITFGTGGFALVVTDRRMAAGRDGPLPTIAWQKAGEAPVHALEGGVYCAASAV
NWAQGLGLFAGHDDIGAFDGAPATLDGPVFVPALAGLACPHWDRRARGAWLGLGLDTGPG
RMMQALLEGIALRMAEVVAVIGRHQPLTDPVPIDGGMAANAYFCRMLADCLERPVIVSDE
PELTAVGTAALAAEVAGVAVATPRRGRRIDPRPLPSGLRARFDAARAAVQAFAAAG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaccattcttgccatcgatcagggcaccaccaccacccgcgccgtgctggtcggg
cccgatggcgggacgcggatcgtggcgagcctgccccatcgccagatccacccggccccc
ggccatgtcgagcacgacccggaagagctgatccggaacctccgcagttgcctcgatgca
gcccgggcggcgggcgcgccgcttgcggtcggcatcgacaatcagggggaaagctgcctc
gcctgggatgcggcgaccggcgaggccatctctccggtgctggtctggcaggatgaccgg
acccgcgacgtcgttgaccggctgcgcgccgacggggccgaggatatggtgctgtcgcgg
gccggcctgccgctcgatccttatttctcggcctccaagcttgcctggatcctgcgcgag
atccctgcggcgcggcggctggcggggctggggcggctccgcctcggcaccaccgatgcc
ttcttccgcgaccggctgaccggacggttcgaaaccgacgtcaccaccgcctcgcgcacc
gcgctcatgaatctcgacagctgcgactgggatcctgagctgtgccggctgtttggcgtg
ccgatcgaggcgctgccgccgatcgggcccagcaccggcgatttcggcaccctggccggc
accggccttcgcctgaccgcaagcctggtcgaccagcaggcctcgctttacggccatggc
tgccggcaggcgggcgacggcaaaatcaccttcggtaccggcggcttcgccctggtggtg
accgaccggcggatggcagcggggcgagacggccccttgcccaccatcgcctggcagaag
gcgggggaggcgccggtccatgcgctggaaggcggggtctattgtgccgcctcggcggtg
aactgggcgcaggggctggggctgtttgccggccatgacgatatcggcgccttcgacggc
gccccggccacgctcgacgggccggtcttcgtgccggcgctggcggggctcgcctgtccg
cattgggaccggcgggcgcgcggcgcctggctggggctggggctcgataccgggccgggc
cggatgatgcaggcgctgcttgaaggcatcgcgctccgcatggccgaagtggtggcggtg
atcggccgccatcagccgctcaccgacccggtaccgatcgatggcggcatggcggccaat
gcctatttctgccggatgctggccgattgtctggaacggccggtgatcgtctccgacgag
ccggagctgaccgcggtcggcactgcagccctggccgccgaggtggcgggggtggcggtc
gccaccccgcgccgcggccggaggatcgacccccggccgctgccgtccggtctgcgcgcg
cgtttcgatgcggcgcgcgcggcggttcaggcttttgccgccgccggctga

DBGET integrated database retrieval system