KEGG   Thermaerobacter marianensis: Tmar_0074Help
Entry
Tmar_0074         CDS       T01388                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tmr  Thermaerobacter marianensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tmr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
69643..70242
Genome map
AA seq 199 aa AA seqDB search
MEHAPAFARLIAELEKLPGIGPKTAQRLAYHLLFRPQDEVRALAEAMVQARASVRYCSIC
FNLTDRDPCPVCRDPGRDARVICVVEQPRDVVAMERTREFRGRYHVLHGVISPMDGIGPE
QLRVRELLARLRQDPPVDEVILATNPTVEGEATALYLARLIKPLGIRVTRIARGVPEGGD
LEYVDELTLTRALQGRQAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtggagcatgcgccggcctttgcccggttgatcgccgagctggagaagctgcccggcatc
ggccccaagaccgcccagcgcctggcgtatcacctgctcttccgcccccaggacgaggtg
cgcgccctggccgaggccatggtccaggcgcgggcgagcgtgcgttattgcagcatctgc
ttcaatctgacggaccgcgacccgtgccccgtctgccgcgatccgggccgcgacgcccgc
gtcatctgcgtggtggagcaaccgcgggacgtggtggccatggagcggacccgggagttc
cgcggccgctaccacgtgctgcacggggtcatctcgcccatggacggcatcggcccggag
cagctgcgggtgcgcgagctcctggcccgcctgcgccaggacccgccggtggatgaggtg
atcctggccaccaacccgacggtggagggggaggccaccgctctctacctggcgcgcctg
atcaagcccctgggcatccgcgtcacccgcatcgcccgcggcgtcccggaaggtggcgac
ctggaatacgtggacgagctcaccctcacgcgagccctgcaggggcgccaggccctgtga

DBGET integrated database retrieval system