KEGG   Thermaerobacter marianensis: Tmar_0089Help
Entry
Tmar_0089         CDS       T01388                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tmr  Thermaerobacter marianensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmar_0089
Enzymes [BR:tmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tmar_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
90162..91169
Genome map
AA seq 335 aa AA seqDB search
MGRRGADDAGFPAGTVRLRAYAKVNLHLRIGPRRPDGYHEIDSVMHRISWHDDLELRVRS
DGAIRLEVVAGGGPGAASLAAVPSGPANLAWRAARLLQEAAGVRRGADIRLVKRVAVGAG
LGGGSADAAAVLFGLRRLWRLPLDARALRRLGEALGADVPFLLGGRAARVRGKGECIEPL
PPWPGLNLVLVPVARPVSTAWAYARWDRVQAARAGGPPPGPSGVEPSGLQPETAGPGGPP
VVWEFDGGAVAEALRNRDLGTLAHLVRNDFEPVVAADVPEVAAALDALRQEGALAARMSG
SGPVVWGIFPNGEAAARACRRLATRFPAARPVRTL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggggcgccgtggggcggatgacgccgggtttcctgccggcacggtgcggttgcgggcg
tacgccaaggtcaacctgcacctgcgcatcggtccgcgccggcctgacggctatcacgag
atcgattcggtgatgcaccgcatcagctggcacgacgacctggagctgcgggtccgatcc
gacggggcgatccgcctggaggtcgtggccggtggtgggcccggtgccgccagcctcgcc
gccgttccatcggggcccgccaacctggcctggcgggccgcgcgcctgcttcaggaggca
gccggcgtccgccggggggccgacatccgcctggtcaagcgggtggcggtcggggcgggg
ctcggtggcggcagcgccgacgcggcggcggtgcttttcggcttgcggcgactgtggcgg
ctccccctggacgcccgggctctgcgccggttgggcgaggccctgggggccgacgtcccg
ttcctcctgggcgggcgggccgcccgggtccggggcaagggggagtgcatcgaacccctg
ccgccgtggcctggactgaacctggtcctcgtgcccgtggcccggccggtgtccacggcc
tgggcctatgcccggtgggaccgggtgcaggcggcgcgggcaggtgggccgccgcccggt
ccatccggggtggaaccgtccggattgcagccggaaacggccgggccgggcgggccgccg
gtggtttgggaattcgacggcggggccgttgccgaggccctgcgcaaccgggacctgggc
accctggcccacctggtgcgcaacgacttcgagccggtggtggcggcggacgtgcccgag
gtggccgcggccctggacgccctgcgccaggaaggggccttggccgcccgcatgagcggc
agcggccccgtggtttgggggatcttccccaacggggaggcggcggcccgggcctgccgg
cgcctggccacgcgcttcccggcggcgcgcccggtgcggacgctctag

DBGET integrated database retrieval system