KEGG   Thermaerobacter marianensis: Tmar_0117Help
Entry
Tmar_0117         CDS       T01388                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tmr  Thermaerobacter marianensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tmr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
118033..119124
Genome map
AA seq 363 aa AA seqDB search
MATRSDTARLLEELAEAPGVPGAEDAVRQVMRRYLEPVAELEQDHLGSLIARRRGTADRP
RILLAAHMDEVGFMVRRITDEGYLKFQPLGGWWGQVLLAQRVTVYTRRGPILGVIGSKPP
HVLPPDERKKTVEIKDMFIDVGASGRQQAEEWGIRPGDPVVPYGPFTRLHNPDLVLAKAL
DDRAGCAVIVRVLEELAGTEHPNTVYGVATVHEEVARTGGGARTSAFAVDPDVAVAVDVG
IAGDVPGVQPDEAQSRLGRGPTVLLFDSSMVPHRRLRDLVADTAEAEGIPYQFDMMPGGA
TDAGFFHVHGRGVPSVVVGPPARYVHSHGAIVHLDDVENTVRLLVALVRRLDAATVDALR
RGG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacacgcagcgatacggcccgcttgctggaagaactggctgaagcgccgggcgtt
cccggcgccgaggatgccgtccgccaggtcatgcggcggtacctggaaccggtggcggag
ctggagcaggaccacctgggcagcctcatcgcccgccggcgcggcacggccgaccggccg
cggatcctgctggccgcccacatggacgaagtcgggttcatggtccgccgcatcaccgac
gagggctacctgaagttccagcccctgggcggctggtggggccaggtcctgctggcccag
cgggtgacggtctacacccgccgcgggcccatcctgggcgtgatcggctccaagccgccc
cacgtgcttcccccggacgagcggaagaagaccgtggagatcaaggacatgttcatcgac
gtgggggcgtccggccgccagcaggccgaggagtgggggatccggcccggcgacccggtg
gtgccctacgggcccttcacccgcctgcacaaccccgacctggtgctggccaaggccctg
gacgaccgggccggttgcgccgtgatcgtccgcgtgctggaggagctggccgggacggag
caccccaacaccgtctacggcgtcgccacggtccatgaggaggtggcccgtaccggtggc
ggggcccgcacgtcggccttcgccgtggaccccgacgtggccgtcgccgtggacgtgggg
atcgccggcgacgtcccgggcgtccagcccgacgaggcgcagagccggctcggccggggc
ccgacggtgctgctgttcgacagcagcatggtaccccaccggcgcctgcgcgacctggtg
gccgatacggccgaggccgaggggatcccgtaccagttcgacatgatgccgggtggcgcc
acggacgccgggttcttccacgtgcacggccgcggggtgccatcggtggtggtcggtccg
ccggcgcggtacgtccacagccacggtgccatcgtccacctggacgacgtggagaacacg
gtgcggctgctggtcgccctggtgcggcggctggacgccgcgacggtggacgcgctgcgc
cggggcggatga

DBGET integrated database retrieval system