KEGG   Thermaerobacter marianensis: Tmar_0119Help
Entry
Tmar_0119         CDS       T01388                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tmr  Thermaerobacter marianensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_0119
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tmar_0119
   00650 Butanoate metabolism
    Tmar_0119
  Energy metabolism
   00190 Oxidative phosphorylation
    Tmar_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
119834..120211
Genome map
AA seq 125 aa AA seqDB search
MSYGEGSPRPASGFELWSWFFMRISGLLLVFLVLGHLYIMHILNSVEIIDYNFVARRWAN
IGWRTYDWVMLALALFHGANGIRVIIDDYAHRPGWRTFWLALLYVVTFILLVLGTVVLVT
FPFPA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtacggagaaggaagcccgcgcccggccagcgggttcgagctgtggtcctggttc
ttcatgcggatctccggcctgctgctggtctttctcgtcctggggcacctctacatcatg
catatcctcaacagcgtggaaatcatcgactacaacttcgtcgcccggcgctgggccaac
atcggctggcgcacctacgactgggtgatgctggccctggcgctcttccatggggccaac
gggatccgggtcatcatcgacgactacgcccaccggccgggatggcgcaccttctggctg
gcgctgctctacgtggtgacgttcatcctgctggtcctgggcaccgtggtcctggtgacc
ttcccgttcccggcctga

DBGET integrated database retrieval system