KEGG   Thermaerobacter marianensis: Tmar_0138Help
Entry
Tmar_0138         CDS       T01388                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tmr  Thermaerobacter marianensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tmr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
149626..150963
Genome map
AA seq 445 aa AA seqDB search
MSPTWQVIPGGLAWGERRFVWGTRTYVMGILNVTPDSFSDGGRYLDPAAAEEHALAMAEA
GADIIDVGAESTRPGAAPVPAEEELRRLLPVIRRLVPRLDVPISVDTYKAEVARAALEEG
AAMINDVGGLHRDPAMAEVAAAHRVPVVAMHARPHGDTAYADFWGEIVSFLRAAMDRATA
AGLPPGMVIVDPGFGFGKTPEQNLDLVRQLPRLRGLGAPVLLGTSRKSTIGRVLDLPVDQ
RLEGTAATVALAIARGVDVVRVHDVAPMVRLVRMADAIARHPHWTEGDEPARRPGAAARP
AAGTEGAVPAGPGPLPAPASRSVIQLRALRFEARHGVLPEEHVKPQPFLVDVDLGLDVTA
AAKTDDLALTVDYGEVHRRVARIVQGPHRQLIETLAHQVASDLLDAFPVDWVRVRVAKPE
APLPGPSAGAAVEVWRNRDGARPAG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccaacctggcaggtgatccccggcggcctggcgtggggcgagcgccggttcgtc
tgggggacccggacctacgtcatggggatcctcaacgtgacccccgactccttctccgac
ggcgggcgctacctggacccggcggccgcggaagaacacgcccttgccatggccgaggcg
ggcgccgacatcatcgacgtgggcgccgagtccacgcggccgggcgcggcgccggtgccc
gccgaggaagagctgcgacggctgctgccggtgatccgacggctggtcccccgtctggac
gtccccatctccgtcgacacctacaaggcggaggtggcccgcgccgctctggaggagggg
gccgccatgatcaacgacgtgggcgggctgcaccgcgaccccgccatggcggaggtggcc
gccgcccaccgggtgccggtggtggcgatgcacgcccggccccacggcgacacggcctac
gccgacttctggggtgagatcgtctccttcctgcgggccgccatggaccgggccaccgcc
gccggcttgccgccgggcatggtgatcgtcgacccgggcttcggcttcggcaagaccccg
gagcagaacctggacctggtccgccagctcccgcgcctccgcgggctgggggcgccggtg
ctgctgggcacgtcgcgcaagagcaccatcggccgcgtgctggacctgccggtggaccag
cgcctggagggtacggccgcgaccgtggccctggccatcgcccgcggcgtcgacgtggtg
cgggtgcacgacgtggcgcccatggtccgcctggtgcggatggcggacgccatcgcccgc
cacccccactggaccgagggggacgaaccggcccggcggcccggcgccgcggcacgaccc
gctgccggcaccgagggggcggtgccggccggacccggcccgttgccggcaccggcctcg
cgcagcgtgatccagctccgggccctgcgctttgaggcgcgccacggcgtgctgccggag
gagcacgtcaagccccagcccttcctggtcgacgtcgacctggggctggacgtgacggcg
gccgctaagaccgacgacctcgccctgaccgtcgactacggcgaggtgcaccggcgcgtg
gcccggatcgtccaggggcctcaccggcagctgatcgagaccctggcccaccaggtggcg
tcggacctgctggacgccttccccgtggactgggtccgcgtgcgggtggccaagcccgag
gcgcccctgccgggaccgtcggcgggcgcggcggtggaggtgtggcgcaaccgtgacggc
gcacgacccgcgggctga

DBGET integrated database retrieval system