KEGG   Thermaerobacter marianensis: Tmar_0380Help
Entry
Tmar_0380         CDS       T01388                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00010  Glycolysis / Gluconeogenesis
tmr00030  Pentose phosphate pathway
tmr00051  Fructose and mannose metabolism
tmr00052  Galactose metabolism
tmr00680  Methane metabolism
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01200  Carbon metabolism
tmr01230  Biosynthesis of amino acids
tmr03018  RNA degradation
Module
tmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_0380
   00030 Pentose phosphate pathway
    Tmar_0380
   00051 Fructose and mannose metabolism
    Tmar_0380
   00052 Galactose metabolism
    Tmar_0380
  Energy metabolism
   00680 Methane metabolism
    Tmar_0380
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tmar_0380
Enzymes [BR:tmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tmar_0380
Protein phosphatases and associated proteins [BR:tmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tmar_0380
Messenger RNA biogenesis [BR:tmr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tmar_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat AIRC Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ADU50503
JGI: Tmar_0380
UniProt: E6SG86
Position
441976..443025
Genome map
AA seq 349 aa AA seqDB search
MEGSGEDAAGGSIAVRPQPVEALGKGEGSRVKRIGLLTSGGDAPGMNAAVRAVVRRALAA
GCVAVGVQEGYAGLIEGWMEELDHRAVGDIIHRGGTILRTARSEAFRTPEGQERALEQLR
RHAIDGLVAIGGDGTLRGALALHRRGFPVVGIPATIDNDLAGTDVTIGFDTAVNTVLEAI
NRVRDTATAHGRTFVIEVMGRHSGQIALMAGLAGGAESILVPEVPYDLDDVCARLLRGRQ
RGKRHSIIVVAEGAARGFEVAQAIEARTGLETRVTVLGHIQRGGTPSGRDRLVASILGAA
AVEVLLQGQSGVMVGVRGDGWVATPIDQILATPRPLPEGWIQLAEVLAR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaagggtcaggagaggacgcggcgggcggcagcatcgccgtcagaccgcagcccgtg
gaggcgttggggaagggggagggctcccgcgtgaaacgcatcgggctgttaaccagtggt
ggcgacgcgcccgggatgaacgcggccgtgcgcgcggtggtgcggcgcgcgctggccgcg
ggctgcgtggccgtgggcgtgcaggaaggctacgcgggcctgatcgaaggctggatggag
gaactggaccaccgcgccgtgggcgacatcatccaccgcggcgggacgatcttgcgcacc
gcgcgcagcgaggcgttccgcaccccggagggccaggagcgggccctcgagcagctccgg
cgccacgccatcgacgggctggtggccatcggcggcgacggcacgctgcgcggcgccttg
gccctgcaccggcgagggttccccgtggtgggcattcccgccaccatcgacaacgacctg
gccggcaccgatgtgaccatcggctttgacaccgcggtcaacacggtgctggaggccatc
aaccgggtgcgggacacggccaccgcccacggccggaccttcgtcatcgaggtcatgggg
cgccacagcggccagatcgccctgatggccggcctggccggcggcgccgagtccatcctg
gtgccggaggtaccctacgacctggacgacgtgtgtgcgcgcctgctgcgcggccgccag
cgcggcaagcgccacagcatcatcgtcgtggcggagggcgccgcccgcggcttcgaggtg
gcccaggccatcgaagcgcgcacgggcctggagacgcgggtgacggtgctgggccacatc
cagcgcggcggcacgccctcgggccgggaccggctggtggccagcatcctgggggcggcg
gcggtggaggtgctgcttcaggggcaatcgggcgtgatggtcggggtgcgcggcgacggc
tgggtggccacgcccatcgaccagatcctggccacgccccgtcccctgcccgaggggtgg
atccagctggccgaggtgcttgcgcgctaa

DBGET integrated database retrieval system