KEGG   Thermaerobacter marianensis: Tmar_0380Help
Entry
Tmar_0380         CDS       T01388                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_0380
   01230 Biosynthesis of amino acids
    Tmar_0380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_0380
   00030 Pentose phosphate pathway
    Tmar_0380
   00051 Fructose and mannose metabolism
    Tmar_0380
   00052 Galactose metabolism
    Tmar_0380
  Energy metabolism
   00680 Methane metabolism
    Tmar_0380
Enzymes [BR:tmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tmar_0380
Protein phosphatases and associated proteins [BR:tmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tmar_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
441976..443025
Genome map
AA seq 349 aa AA seqDB search
MEGSGEDAAGGSIAVRPQPVEALGKGEGSRVKRIGLLTSGGDAPGMNAAVRAVVRRALAA
GCVAVGVQEGYAGLIEGWMEELDHRAVGDIIHRGGTILRTARSEAFRTPEGQERALEQLR
RHAIDGLVAIGGDGTLRGALALHRRGFPVVGIPATIDNDLAGTDVTIGFDTAVNTVLEAI
NRVRDTATAHGRTFVIEVMGRHSGQIALMAGLAGGAESILVPEVPYDLDDVCARLLRGRQ
RGKRHSIIVVAEGAARGFEVAQAIEARTGLETRVTVLGHIQRGGTPSGRDRLVASILGAA
AVEVLLQGQSGVMVGVRGDGWVATPIDQILATPRPLPEGWIQLAEVLAR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaagggtcaggagaggacgcggcgggcggcagcatcgccgtcagaccgcagcccgtg
gaggcgttggggaagggggagggctcccgcgtgaaacgcatcgggctgttaaccagtggt
ggcgacgcgcccgggatgaacgcggccgtgcgcgcggtggtgcggcgcgcgctggccgcg
ggctgcgtggccgtgggcgtgcaggaaggctacgcgggcctgatcgaaggctggatggag
gaactggaccaccgcgccgtgggcgacatcatccaccgcggcgggacgatcttgcgcacc
gcgcgcagcgaggcgttccgcaccccggagggccaggagcgggccctcgagcagctccgg
cgccacgccatcgacgggctggtggccatcggcggcgacggcacgctgcgcggcgccttg
gccctgcaccggcgagggttccccgtggtgggcattcccgccaccatcgacaacgacctg
gccggcaccgatgtgaccatcggctttgacaccgcggtcaacacggtgctggaggccatc
aaccgggtgcgggacacggccaccgcccacggccggaccttcgtcatcgaggtcatgggg
cgccacagcggccagatcgccctgatggccggcctggccggcggcgccgagtccatcctg
gtgccggaggtaccctacgacctggacgacgtgtgtgcgcgcctgctgcgcggccgccag
cgcggcaagcgccacagcatcatcgtcgtggcggagggcgccgcccgcggcttcgaggtg
gcccaggccatcgaagcgcgcacgggcctggagacgcgggtgacggtgctgggccacatc
cagcgcggcggcacgccctcgggccgggaccggctggtggccagcatcctgggggcggcg
gcggtggaggtgctgcttcaggggcaatcgggcgtgatggtcggggtgcgcggcgacggc
tgggtggccacgcccatcgaccagatcctggccacgccccgtcccctgcccgaggggtgg
atccagctggccgaggtgcttgcgcgctaa

DBGET integrated database retrieval system