KEGG   Thermaerobacter marianensis: Tmar_0507Help
Entry
Tmar_0507         CDS       T01388                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_0507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_0507
   00052 Galactose metabolism
    Tmar_0507
   00500 Starch and sucrose metabolism
    Tmar_0507
   00520 Amino sugar and nucleotide sugar metabolism
    Tmar_0507
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tmar_0507
   00524 Butirosin and neomycin biosynthesis
    Tmar_0507
Enzymes [BR:tmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tmar_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
602462..603523
Genome map
AA seq 353 aa AA seqDB search
MAIHRDRYGTASGDPAPGAAAREAAGAGTAAGTGGGAGDGVVLGIDLGGTKIALGLVDRR
GKVLADVTLPTEATAGPAAAMDRLAAAARQLAARADRKPLAAGVGAPGPLLLPEGRFTGT
PNLPGWNGFALRDELARRLGIPVAVNNDANAAALAEARLGAGRGAAVMVYVTVGTGIGGG
LVVGGKLFSGVNGNGVEIGHTTLDPDGPPCGCGNRGCWEALASGPALARLAGERLGPSPR
RPGGQWTAKDLLEAAAAGDPAARAVADEYARRLGVGLANAVNAFNPDRLVLGGGVMARYD
LLAPAMEAEMRRRALPANAAAVALAPATLGKRAGLVGAALLAWDLLDEPGPGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctattcacagggatcggtatgggaccgcgtccggcgatcccgcgccaggcgccgcg
gcccgggaggccgccggggcggggaccgccgccggcaccggcggaggtgccggggacggg
gtcgtcctggggatcgacctcgggggaaccaagatcgctctgggactggtggaccgccgg
ggcaaggtgctggccgacgtcaccttgcccaccgaggcgacggccggtccggcggcggcc
atggaccgcctcgccgccgccgcccgccagctggcggcccgggccgaccggaagccgctg
gcggccggggtgggggcgccgggtccgctgctgctgcccgagggccggttcaccggcacg
cccaacctgcccggctggaacggattcgccttgcgggacgagctggcgcgccggctggga
atccccgtcgccgtcaacaacgacgccaacgccgccgccctggccgaggcgcgcctgggt
gccggccggggggcggcggtcatggtctacgtgaccgtgggaacgggcatcggcggtggc
ctggtggtcggcggcaagctgttcagcggggtcaacggcaacggggtggagatcgggcac
acgaccctggaccccgacgggccgccctgcggctgcggcaaccgcgggtgctgggaggcc
ctggcctccggcccggccctggcccggctagccggcgagcgtctgggcccctcgccccgc
cggcccggcgggcagtggacggccaaggacctgctcgaggcggcggccgccggcgaccct
gccgcgcgggcggtggcggacgagtacgcccggcgcctcggtgtggggctggccaatgcc
gtcaacgcgttcaaccccgaccgcctggtgctggggggcggggtgatggcccgttacgac
ctgctggcgccggcgatggaggcggagatgcgccgccgggccctgccggccaacgcggcg
gcggtggccctggcgccggccaccctgggcaagcgggcggggctggtgggggcggccctg
ctggcctgggacctgctggacgaacccggcccggggcggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system