KEGG   Thermaerobacter marianensis: Tmar_0546Help
Entry
Tmar_0546         CDS       T01388                                 

Definition
molybdopterin dehydrogenase FAD-binding protein
Orthology
K03519  
carbon-monoxide dehydrogenase medium subunit [EC:1.2.99.2]
Organism
tmr  Thermaerobacter marianensis
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_0546
  Energy metabolism
   00680 Methane metabolism
    Tmar_0546
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tmar_0546
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.99  With other, unknown, acceptors
    1.2.99.2  carbon-monoxide dehydrogenase (acceptor)
     Tmar_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
650185..651093
Genome map
AA seq 302 aa AA seqDB search
MIPSAFTYHRPQTLEEVFELLGRHGDQAKLLAGGHSLLPAMKLRLAQPQVLIDLGRVREL
AGVSVEPDGALRLGALTTHHQVMTDPVVRRHAPLLAEVAGVIGDMQVRYRGTLGGSIAHA
DPAADYPAALLALEAEIEVAGPGGRRTVPAGEFFFGPFITALQPDEVVTAVRIPAAAGAD
QGWRWGYRYLKMARRASDFALVGVAAAIAREGQGAAAAVRVALNGVTGAAYRAAAVEEHL
AGRVPSEELFAEAAARAVDGVDVDGDALTSAEYRAHLARVYTRRALAEAWQRAGGQAAMA
AG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatccccagcgccttcacctatcaccggcctcagacgctggaggaggtcttcgaactg
ctggggcgtcacggcgaccaggccaagctactggcgggcgggcacagcctgctgccggcc
atgaagctgcgcctggcccagccccaggttctgatcgacctgggccgggtgcgggaactg
gccggggtgtcggtggaacccgacggggccctgcggctcggcgccctgacgacccaccac
caggtgatgaccgacccggtggtgcgccggcacgcgcccctgctggccgaggtggccggg
gtcatcggcgacatgcaggtgcgctaccgcggcaccctgggcggcagcatcgcccacgcc
gacccggccgccgactaccccgccgccttgctcgccctggaggccgagatcgaggtggcc
gggcccggcggccggcgcacggtgccggcgggcgagttcttcttcggccccttcatcacc
gccctgcagcccgacgaggtggtcaccgccgtccgcatcccggcggccgccggggcggac
cagggctggcggtggggctaccgctacctgaagatggcccgccgggcgtcggacttcgcc
ctggtgggcgtggcggcggccatcgcccgggaagggcagggtgcggcggccgcggtgcgg
gtcgccctcaacggggtgacgggggccgcctaccgggccgcggcggtcgaggagcacctg
gcgggccgggtgccgtcggaggaactcttcgcggaagccgccgcccgggccgtagacggg
gtggacgtggacggcgacgccctgacctccgccgagtaccgcgcccacctggcccgggtg
tatacccgccgggcgctggcggaagcctggcagcgggccggcggccaggcggccatggcc
gccggctga

DBGET integrated database retrieval system