KEGG   Thermaerobacter marianensis: Tmar_0546Help
Entry
Tmar_0546         CDS       T01388                                 

Definition
molybdopterin dehydrogenase FAD-binding protein
Orthology
K03519  
carbon-monoxide dehydrogenase medium subunit [EC:1.2.99.2]
Organism
tmr  Thermaerobacter marianensis
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tmr01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:tmr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
650185..651093
Genome map
AA seq 302 aa AA seqDB search
MIPSAFTYHRPQTLEEVFELLGRHGDQAKLLAGGHSLLPAMKLRLAQPQVLIDLGRVREL
AGVSVEPDGALRLGALTTHHQVMTDPVVRRHAPLLAEVAGVIGDMQVRYRGTLGGSIAHA
DPAADYPAALLALEAEIEVAGPGGRRTVPAGEFFFGPFITALQPDEVVTAVRIPAAAGAD
QGWRWGYRYLKMARRASDFALVGVAAAIAREGQGAAAAVRVALNGVTGAAYRAAAVEEHL
AGRVPSEELFAEAAARAVDGVDVDGDALTSAEYRAHLARVYTRRALAEAWQRAGGQAAMA
AG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatccccagcgccttcacctatcaccggcctcagacgctggaggaggtcttcgaactg
ctggggcgtcacggcgaccaggccaagctactggcgggcgggcacagcctgctgccggcc
atgaagctgcgcctggcccagccccaggttctgatcgacctgggccgggtgcgggaactg
gccggggtgtcggtggaacccgacggggccctgcggctcggcgccctgacgacccaccac
caggtgatgaccgacccggtggtgcgccggcacgcgcccctgctggccgaggtggccggg
gtcatcggcgacatgcaggtgcgctaccgcggcaccctgggcggcagcatcgcccacgcc
gacccggccgccgactaccccgccgccttgctcgccctggaggccgagatcgaggtggcc
gggcccggcggccggcgcacggtgccggcgggcgagttcttcttcggccccttcatcacc
gccctgcagcccgacgaggtggtcaccgccgtccgcatcccggcggccgccggggcggac
cagggctggcggtggggctaccgctacctgaagatggcccgccgggcgtcggacttcgcc
ctggtgggcgtggcggcggccatcgcccgggaagggcagggtgcggcggccgcggtgcgg
gtcgccctcaacggggtgacgggggccgcctaccgggccgcggcggtcgaggagcacctg
gcgggccgggtgccgtcggaggaactcttcgcggaagccgccgcccgggccgtagacggg
gtggacgtggacggcgacgccctgacctccgccgagtaccgcgcccacctggcccgggtg
tatacccgccgggcgctggcggaagcctggcagcgggccggcggccaggcggccatggcc
gccggctga

DBGET integrated database retrieval system