KEGG   Thermaerobacter marianensis: Tmar_0546Help
Entry
Tmar_0546         CDS       T01388                                 

Definition
(GenBank) molybdopterin dehydrogenase FAD-binding protein
  KO
K03519  
aerobic carbon-monoxide dehydrogenase medium subunit [EC:1.2.5.3]
Organism
tmr  Thermaerobacter marianensis
Brite
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     Tmar_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
650185..651093
Genome map
AA seq 302 aa AA seqDB search
MIPSAFTYHRPQTLEEVFELLGRHGDQAKLLAGGHSLLPAMKLRLAQPQVLIDLGRVREL
AGVSVEPDGALRLGALTTHHQVMTDPVVRRHAPLLAEVAGVIGDMQVRYRGTLGGSIAHA
DPAADYPAALLALEAEIEVAGPGGRRTVPAGEFFFGPFITALQPDEVVTAVRIPAAAGAD
QGWRWGYRYLKMARRASDFALVGVAAAIAREGQGAAAAVRVALNGVTGAAYRAAAVEEHL
AGRVPSEELFAEAAARAVDGVDVDGDALTSAEYRAHLARVYTRRALAEAWQRAGGQAAMA
AG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatccccagcgccttcacctatcaccggcctcagacgctggaggaggtcttcgaactg
ctggggcgtcacggcgaccaggccaagctactggcgggcgggcacagcctgctgccggcc
atgaagctgcgcctggcccagccccaggttctgatcgacctgggccgggtgcgggaactg
gccggggtgtcggtggaacccgacggggccctgcggctcggcgccctgacgacccaccac
caggtgatgaccgacccggtggtgcgccggcacgcgcccctgctggccgaggtggccggg
gtcatcggcgacatgcaggtgcgctaccgcggcaccctgggcggcagcatcgcccacgcc
gacccggccgccgactaccccgccgccttgctcgccctggaggccgagatcgaggtggcc
gggcccggcggccggcgcacggtgccggcgggcgagttcttcttcggccccttcatcacc
gccctgcagcccgacgaggtggtcaccgccgtccgcatcccggcggccgccggggcggac
cagggctggcggtggggctaccgctacctgaagatggcccgccgggcgtcggacttcgcc
ctggtgggcgtggcggcggccatcgcccgggaagggcagggtgcggcggccgcggtgcgg
gtcgccctcaacggggtgacgggggccgcctaccgggccgcggcggtcgaggagcacctg
gcgggccgggtgccgtcggaggaactcttcgcggaagccgccgcccgggccgtagacggg
gtggacgtggacggcgacgccctgacctccgccgagtaccgcgcccacctggcccgggtg
tatacccgccgggcgctggcggaagcctggcagcgggccggcggccaggcggccatggcc
gccggctga

DBGET integrated database retrieval system