KEGG   Thermaerobacter marianensis: Tmar_0572Help
Entry
Tmar_0572         CDS       T01388                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tmr  Thermaerobacter marianensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tmar_0572
Enzymes [BR:tmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Tmar_0572
Peptidases [BR:tmr01002]
 Cysteine Peptidases
  Family C44
   Tmar_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
683913..685481
Genome map
AA seq 522 aa AA seqDB search
MCGIAGATAPRGEAVARMLEAMAHRGPDDQGLWVGEHTLGHRRLSIIDLAGGHQPLANED
GTIRVVFNGEIYNYRELREELAARGHRFRTASDTEVLVHLYEDEGPAMVRRLYGMFAFAL
STPDGLMLARDPLGIKPLYVGRDRHGALLFASEVGALLPHVETLEEFPAGHYWTEGDGFV
RYYELPPVRYDLPSPEAAVEELTARLRQAVRRRLVADVPVGVFLSGGLDSSLIAALVAEA
RAQTGEPVHSFAVGMEGSEDLERARLVAAHLGTIHHEHVFTREELLALLPEVIRRLESFD
AALVRSAVPTYLVSRLARRYVKVVLSGEGADELFGGYQYLKRPEIRARLQDELREITLGL
HNTNLQRVDRMTMAHGLEGRVPFLSVTMVDLAWRIPPRWKIHDRTGTEKWILRQAARRFL
PAAIVQREKAKFAIGTGVGPTLEAFAEAAVSDREWEAGRRPWPGLELGSKEELLYFRWFC
QAFGPGARKAARLVGRSRSLNPHQLYAPAWRAQASGAGTATR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgccggtgccaccgctccccgcggtgaagcggtggcccgcatgctggag
gccatggcgcaccggggacccgacgaccagggcctgtgggtgggcgagcacaccctgggc
caccgtcgcctgtcgatcatcgacctggcgggcgggcaccagcccctggccaacgaagac
ggcacgatccgcgtggtgttcaacggcgagatctacaactaccgcgagctgcgggaggaa
ctggccgcccgcggccaccgcttccgcaccgccagcgataccgaggtcctggtccacctc
tacgaggacgagggcccggcgatggtgcggcggctgtacggcatgttcgccttcgccctt
tcgacccccgacgggctcatgctggcccgcgatcccctgggcatcaagccgctctacgtg
ggacgggaccgccacggcgcgctgctcttcgcctcggaggtcggcgccctgctgccccac
gtggagaccctggaggagttccccgccggccactactggacggagggggacgggttcgtc
cggtactacgagctgccgccggtgcggtacgacctgcccagccccgaagccgcggtggag
gaactcaccgcgcgcctgcggcaggcggtgcggcggcggctggtggccgacgtgccggtg
ggcgtattcctcagcgggggcctggatagcagcctgatcgccgcgctggtggcggaggcg
cgggctcagaccggagagccggtccattccttcgccgtgggcatggagggcagcgaggac
ctggaacgggcgcggctggtggcggcgcacctggggacgatccaccacgagcacgtcttc
acccgggaggagctgctggcgctgctgcccgaggtgatccggcgcctggagtccttcgac
gcggccctggtgcgcagcgccgtgcccacctatctggtctcgcggctggcgcgccgctac
gtcaaggtggtgctctcgggcgagggagcggacgagctcttcggcggttaccagtacctc
aagcggccggagatccgggcgcggctgcaggacgagctgcgggagatcaccctgggtctg
cacaacaccaacctgcagcgggtcgaccgcatgaccatggcccatggcctggagggacgg
gttcccttcctgtcggtcaccatggtggacctggcctggcgcatcccgccgcggtggaag
atccacgaccgcaccggcaccgagaagtggatcctgcgccaggcggcgcgccggttcctc
cccgccgccatcgtgcagcgggagaaggccaagttcgccatcggcacgggcgtggggccc
acgctggaagccttcgccgaggcggccgtcagcgaccgcgagtgggaggccggccgccgg
ccgtggccgggcctggagctgggcagcaaggaggagctgttgtacttccgctggttctgc
caggccttcgggccgggagcgcgcaaggcggcgcgccttgtgggccgcagccgcagcctc
aacccgcaccagctctatgccccggcctggcgggcccaagcatccggcgcgggaacggcc
acgcggtaa

DBGET integrated database retrieval system