KEGG   Thermaerobacter marianensis: Tmar_0675Help
Entry
Tmar_0675         CDS       T01388                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmr  Thermaerobacter marianensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tmar_0675
   00052 Galactose metabolism
    Tmar_0675
   00500 Starch and sucrose metabolism
    Tmar_0675
   00520 Amino sugar and nucleotide sugar metabolism
    Tmar_0675
Enzymes [BR:tmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tmar_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
814424..815377
Genome map
AA seq 317 aa AA seqDB search
MPRTVRKAVIPAAGLGTRFLPATKAQPKEMLPVVDKPIIQYVVEEAVAAGIDDILIVTGR
GKRAIEDHFDRSIELEWHLERGHKDEMLEWVRYIADLADVHFVRQKEPLGLGHAVLQARR
HVGDEPFAVLLGDEIFIGEEPALAELIDCYRETGASVVAVREVPREQVRRYGVVDGEPAG
QRLFRVRDMVEKPDPAEAPSNLAIVGRYIIEPEIFDLLERVGRGKNDEIQLTDALRLLAR
DQAVYAYQTRSRRYDVGEKLGFLQATVEFALMRPELASDFRDYLVGLVEELKAGRWPGVE
RAAATRQAGPAPLRRPR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgccacgtaccgtccgcaaggccgtgatcccggcggccggcctgggcacgcgcttcctg
ccggccaccaaggcccagcccaaggagatgctgcccgtcgtcgacaagcccatcatccag
tacgtggtcgaagaggcggtggccgccggcatcgacgacatcctgatcgtcaccgggcgc
ggcaagcgcgccatcgaagaccacttcgaccgctccatcgaactggagtggcacctggag
cgcggccacaaggacgagatgctggagtgggtgcgctatatcgccgacctggcggacgtg
cacttcgtccggcagaaggagcccctgggcctgggccacgccgtcctgcaggcccgccgc
cacgtgggcgacgagcccttcgccgtcctcctgggcgacgagatcttcatcggggaagaa
ccggccctggctgagctcatcgactgctaccgtgagacgggggccagcgtggtggcggtg
cgggaggtgccccgggagcaggtgcgccgctacggcgtggtcgacggggagccggccggc
cagcggctcttccgggtccgggacatggtggagaagcccgaccccgccgaggcgccctcc
aacctggccatcgtgggccggtacatcatcgagccggagatcttcgacctgctggagcgg
gtggggcgcggcaagaacgacgagatccagctcaccgacgccctgcgcctgctggcccgg
gaccaggcggtgtacgcgtaccagacccggtcgcgccgctacgacgtgggggagaagctg
ggctttttgcaggccacggtggagttcgccctgatgcggcccgagctggcgtccgacttc
cgcgactacctggtggggctggtggaggagctcaaggcgggccgctggccgggggtcgaa
cgcgccgcagccacgcgccaggcgggcccggcgccgctccggcggccgcggtag

DBGET integrated database retrieval system