KEGG   Thermaerobacter marianensis: Tmar_0726Help
Entry
Tmar_0726         CDS       T01388                                 

Definition
glutamine--fructose-6-phosphate transaminase (isomerizing) (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
tmr  Thermaerobacter marianensis
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tmar_0726
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tmar_0726
Enzymes [BR:tmr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Tmar_0726
Peptidases [BR:tmr01002]
 Cysteine Peptidases
  Family C44
   Tmar_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
876313..877260
Genome map
AA seq 315 aa AA seqDB search
MFVGCGSSHYLALYGAHLAQQLAKRPGAAVTASEAWLAPDVHLWPWSNPFVVAISRSGAT
TEVVRAVQVARQRGIPTLALTTNPDAPLVRECDASLVLDHVTERSVVMTQSFANLLLALQ
YLVALGAGTPAAHSFESRLPAVTQAVADVFPRLAEAAREVVGRGWRRYVFLGTGPLYPVA
CEARLKVQEMTQGKAHAFVTLEFRHGPLSLVDGETCVTILTTPATAALDRELAGEVAALG
AQVVLVGPQVRAGGTTRSSPVTGVPLPEGLEDAHYAGLALPFLQVLALEQTLLLGKNPDT
PRHLSHVVTLHDDQG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgtcggctgcggttcatcccattacctggcgctgtacggtgcccacctggcacag
cagctggccaagcgacctggggcggcggtgacggcctccgaagcgtggctcgcccccgat
gtccatctttggccctggtcgaacccctttgttgtggccatctcccgctcgggggccacc
acggaggtggttcgggccgtccaggtggcccggcagcggggcatcccgaccctggccctg
accaccaatcccgacgccccgctggtgcgggagtgcgacgccagcctggtgctcgatcac
gtgaccgagcggagcgtggtgatgacccaatccttcgccaacctgctgctggcgctgcag
tacctagttgccctgggcgcaggcacgcccgcggcccactcgtttgaatcccgtctgccc
gctgtcacccaggccgtggcggacgtctttccccggctggcggaggcggcccgcgaggtg
gttggtcgggggtggcggcggtacgtttttctcgggaccggtccgctttaccccgtggct
tgcgaagcgcgcctgaaggtccaggaaatgacgcaagggaaggcccatgcgtttgtgacg
ctggagttccggcacggcccgctgtccctggtcgacggcgaaacctgcgtcaccatcctc
accaccccggcgacggcggcgctcgatcgggaactggccggcgaagtggcggcgctgggc
gcccaggtggtgctggtggggccgcaagtccgggcgggaggtacgacccgatcctcgccc
gtgacgggggtgccgctgcccgaggggcttgaggacgcccactatgcagggctcgccttg
ccgtttcttcaagttttggccttggaacaaaccctcctcttgggcaagaacccggacacg
ccacggcacctgagccacgtggtcaccctgcacgatgaccagggttaa

DBGET integrated database retrieval system