KEGG   Thermaerobacter marianensis: Tmar_0848Help
Entry
Tmar_0848         CDS       T01388                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tmr  Thermaerobacter marianensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tmar_0848
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tmar_0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1026886..1027557
Genome map
AA seq 223 aa AA seqDB search
MIAFLRGELVALAGDEVWIDVGGVGFRVAVSRQTQRRLPPAGEPVRLLTRLVVREDQWSL
YGFATADEQAAFDALLTVSGVGPRVALAVLSVLSPEELRRAVVLQDPALLTRVPGVGPKL
ARRLLTELRDRLGEPLAEGAAAGAVAPAGGAASTPGGLPGGVATSPREDALAALESLGYS
RAEAEGALAAAAGEVEPDAPAAAWVRAALRALGGARAAGGAGR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccttcctgcgcggcgagctggtggcgctggctggcgatgaagtatggattgat
gtgggcggtgtcggattccgggtggccgtttcccggcagacccagcggcggctgccgccg
gcgggggagccggtgcggctcctgacccgcctggtggtgcgggaagaccagtggtccctc
tacggcttcgccacggccgacgagcaggcggccttcgacgccctgctgaccgtcagcggc
gtggggccgcgggtggccctggccgtgctgtcggtcctcagcccggaggaactgcgccgg
gccgtggtgctgcaggatccggccctgctcacccgggtgccgggggtgggtcccaagctg
gcgcggcgcctgctgacggaactgcgcgaccggctgggtgaacccctggcggaaggtgcg
gcggcaggggcggtggcaccggcgggcggggcggcgagcacgccgggtggcctgcccggc
ggggtcgcaaccagcccccgggaggatgccctggcggccctggagtccctgggctacagc
cgcgccgaagcggagggcgccctggcggccgccgccggtgaggtcgaacccgacgccccg
gcggcggcctgggtgcgggcggcgctgcgggccctgggcggggcccgcgcggcgggaggt
gcgggccggtga

DBGET integrated database retrieval system