KEGG   Thermaerobacter marianensis: Tmar_0865Help
Entry
Tmar_0865         CDS       T01388                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tmr  Thermaerobacter marianensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tmr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tmr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1045508..1047019
Genome map
AA seq 503 aa AA seqDB search
MVNLKDLIAVLPEKTVTGPVDRPIQGITYDSRRVEPGFLFVAIRGLRYDGHSFIQEAVAR
GAAAVVGERAPAVEGVPYVQVPSSRTALGLLASAFYGHPSARLVLVGVTGTNGKTTTTHL
VRWVLEAAGHPTGLIGTVHNIIGGRSLPVERTTPEAADLQKLLAAMRDAGLTHVVMEVSS
HALTLQRVAGCAFDVGVFTNLTQDHLDFHASMEDYAAAKARLFARLGRNEIPGTVKPGPK
AAVINADDPWGTFMADRSSAPVITYGIRQAADVTARDVVVEPGGVRFVLGTRDGEVPVRL
RLTGRFNVYNALAAAGAGLALGIDPATVARGLESLPAVPGRLERIDRGQPFTVLVDYAHT
PDGLENVLSTVREMAGQGRVLCVFGCGGDRDRGKRPQMGAIAARLADYTVLTSDNPRSED
PEAIIDDIEAGVRQVPGAAYERVTERAAAIRRVLELARPGDVVVIAGKGHEDYQIFADRT
IHFDDREVAATALEAMGYGGAKG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatctgaaggatctcatcgccgtcctgcccgagaagaccgtgaccggtcccgtg
gaccggcccatccagggcatcacctacgactcccggcgcgtcgagccgggcttcctcttc
gtggccatccgcggcttgcgttacgacggccactccttcatccaggaggccgtggcgcgg
ggtgccgcggcggtggtgggtgaacgcgcgcccgctgtggagggcgtcccctacgtgcag
gtcccctccagccggacggccctgggcctgctggcgtcggccttctacggccaccccagc
gcccgcctggtgctggtcggggtgaccgggaccaacggcaagacgaccaccacccacctg
gtgcggtgggtgctggaggcggcgggccaccccaccggcctcatcggcacggtgcacaac
atcatcggcgggcgatccctgccggtcgaacgcaccacccccgaggcggccgacctgcag
aagctcctggccgccatgcgggacgcggggctgacccacgtggtgatggaggtctcttcc
catgccctgaccctgcagcgggtggcgggctgcgccttcgacgtgggcgtgttcaccaac
ctcacccaggaccacctggacttccacgcttcgatggaggactatgcggcggccaaggcg
cgattgttcgcccggctgggacgcaacgagatccccggcaccgtcaagccgggtcccaag
gcagccgtgatcaacgccgacgacccctgggggaccttcatggcggaccgcagcagcgcg
ccggtcatcacgtacggcatccgccaggcggcggacgtcacggcccgtgacgtggtggtg
gaacccggcggcgtccggttcgtcctgggcacccgggacggggaggtgcccgtgcgcctg
cggctgacgggccggttcaacgtctacaacgcgctggcggcggcgggcgcgggcttggcc
ttggggatcgacccggccacggtggcgcggggcctggagagcctgccggcggtgccgggg
cggcttgagcgcatcgaccgggggcagcccttcaccgtgctggtggattacgcccatacc
cccgacgggctggagaatgtgctctccacggtgcgggagatggcggggcaggggcgggtc
ctctgcgtcttcggctgcggcggcgaccgcgaccggggcaagcgaccccagatgggtgcc
atcgcggcgcggctggccgactacacggtgctgacctccgacaacccgcgcagcgaggac
cccgaggccatcatcgacgacatcgaggcgggggtgcggcaggttcccggggccgcctac
gagcgggtgacggagcgggcggcggccatccgccgggtgctggagctggcccggcccggc
gacgtggtggtcatcgccggcaaggggcacgaggactaccagatcttcgccgaccgcacc
atccacttcgacgaccgggaggtggcggcgacggccctggaagccatggggtacggcggt
gccaagggttga

DBGET integrated database retrieval system