KEGG   Thermaerobacter marianensis: Tmar_0889Help
Entry
Tmar_0889         CDS       T01388                                 

Definition
fructose-bisphosphate aldolase; D-fructose 1,6-bisphosphatase (EC:3.1.3.11 4.1.2.13)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_0889
   01230 Biosynthesis of amino acids
    Tmar_0889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_0889
   00030 Pentose phosphate pathway
    Tmar_0889
   00051 Fructose and mannose metabolism
    Tmar_0889
  Energy metabolism
   00680 Methane metabolism
    Tmar_0889
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Tmar_0889
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Tmar_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1075622..1076734
Genome map
AA seq 370 aa AA seqDB search
MDVTVSVIKADVGSVAGHTRPSDELLEAVRQRVEAEKGGLLLDARVFFCGDDISILMTHQ
RPPGDEAVHRVAWEAFRAGTAVAQRQGLYGAGQDLLKDAFSGNVRGMGPQVAELALRERP
NEALMILAADKTEPGAFNLPLYLAFADPMYSPGLLLSEELHAGFRFVIMDVEHTEGDRLI
TLDAPERLYDIAALLRDTHRYVIAAIWSRKYPDEQAAAVSTTRLRQIAGRYVGKDDPVAI
VRVQKIFPATEEFGPPFALGAFVAGDTRGSHNLPLLPVPVNTPASTFFCHPMVAALGFSM
RDGQLTGPVDLFADPVWEPIRHRIVAKALGMRQQGFFQPAMLPISELEYGGITARLRRLD
AEFRVEVAKE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcacggtgagcgtgatcaaggccgacgtgggcagcgtggccggccacacccgc
cccagcgacgagctgctggaggccgtgcggcagcgggtcgaggcggagaagggcggcctg
ctgctggacgcccgcgtgttcttctgtggcgacgacatctccatcctcatgacccaccag
cgcccgccgggggacgaggcggtgcaccgcgtggcgtgggaagccttccgggccggtacc
gcggtggcccagcgccaggggttgtacggcgcggggcaggacctgctgaaggacgccttc
tcgggcaacgtgcgcggcatgggcccccaggtggccgagctggccctgcgcgagcggccc
aacgaggcgctgatgatcctggccgccgacaagacggagcccggcgccttcaacctgccg
ctgtacctcgccttcgccgaccccatgtactcgccgggcctgctgctctcggaagagctc
cacgccgggttccggttcgtcatcatggacgtggagcacaccgagggcgaccgtctcatc
accctggacgcccccgagcggctctacgacatcgcggccctgctgcgggacacccaccgg
tacgtcatcgcggccatctggtcgcgcaagtacccggacgaacaggccgcggccgtcagc
accacgcgcctgcggcagatcgccggccgctacgtgggcaaggacgaccccgtggccatc
gtgcgggtgcagaagatcttccccgccaccgaggagttcggaccgcccttcgccctgggc
gccttcgtggccggcgatacccggggcagccacaacctgcccctgctgccggtgcccgtg
aacactccggccagcaccttcttctgccatcccatggtggcggcgctgggcttctccatg
cgcgacggccagctgaccggccccgtcgacctcttcgccgacccggtgtgggagcccatc
cggcaccgcatcgtggccaaggcccttggcatgcggcaacagggcttcttccagcccgcc
atgctgcccatctccgagctggagtacggtggcatcaccgcgcgcctcaggcggctcgac
gccgagttccgggtggaggtggcgaaggagtag

DBGET integrated database retrieval system