KEGG   Thermaerobacter marianensis: Tmar_1010Help
Entry
Tmar_1010         CDS       T01388                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00900  Terpenoid backbone biosynthesis
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmar_1010
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tmar_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ADU51123
JGI: Tmar_1010
UniProt: E6SJR0
Position
1219972..1221159
Genome map
AA seq 395 aa AA seqDB search
MADRETGVVILGSTGSIGRQAAEVIARMPGRLRAVALAAGRDGARLLEQVRRLRPEAVAL
EDPEAGRAWRPALEREGVKVLVGPGAAEELAAWPGATRVLSAITGAAGLRPTLAALRAGR
DVALANKESLVAAGALVTRQAAAAGVRIIPVDSEHSALFQCLQGRSPDEVERLVLTASGG
PFRGWPAEALHRVTPEQAVRHPNWSMGAKISVDSATLMNKGLEVIEARWLFGLPASRIGV
VVHPQSVVHGLVELADGATVAVLAPPDMRQPIQYALCYPERGPRLVERLDLAAVGKLTFE
EPDTRTFPCLDLAYRALEAGGTAPAVLNAANEEAVAAFLAGRLSFPGIAETVAAVLAAHR
PRPVTGLDDVLEADAWARDQARARVAAGAPGPGLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgggaaacgggcgtggtcatcctgggcagcaccggctccatcgggcgccag
gcggccgaggtgatcgcccgcatgccgggccggctgcgggccgtggccctggccgccggc
cgcgacggggcgcggctgctggagcaggtgcggcggctgcggcccgaggccgtcgccctg
gaagaccccgaggccggccgggcgtggcgcccggccctggaacgggaaggggtcaaggtg
ctggtggggccgggggcggcggaggaactggccgcatggccgggggccacgcgggtgctc
tccgccatcaccggggccgccgggctgcggccgaccctggcggcgctgcgggccggccgc
gacgtggccctggccaacaaggagtccctggtggccgccggcgccctggtgacccgccag
gcggcggcggcgggcgtgcggatcatccccgtggacagcgagcactccgccctcttccaa
tgcctgcagggccgctcacccgacgaagtggagcgcctggtcctgacggcatccgggggc
cccttccgcggctggcccgccgaggccctgcatcgggtgacgcccgagcaggccgtccgc
caccccaactggtccatgggcgccaagatcagcgtcgactccgccaccctgatgaacaag
ggcctggaggtcatcgaggcccgctggctcttcgggctgccggcctcgcgcatcggcgtg
gtggtccatccccagagcgtggtccacggcctggtggaactggccgacggcgccacggtg
gcggtgctggccccgcccgacatgcgccagccgatccagtacgccctgtgttatcctgaa
cgtggaccccggctggtggagcgcttggatctcgccgccgtgggcaagctgacctttgaa
gaacccgacacccgcaccttcccgtgcctggacctggcgtaccgggcgctggaggcgggc
ggcacggcgccggccgtcctcaacgccgccaacgaggaagcggtggcggccttcctggcc
ggccggctttccttcccgggcatcgccgagacggtggcggcggtgctggccgcccaccgg
ccgcggcccgtcaccggcctggacgacgtcttggaggccgacgcctgggcccgggaccag
gcgcgggcgcgggtggcggccggcgcgccggggccgggcttgcgatga

DBGET integrated database retrieval system