KEGG   Thermaerobacter marianensis: Tmar_1085Help
Entry
Tmar_1085         CDS       T01388                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00071  Fatty acid degradation
tmr00280  Valine, leucine and isoleucine degradation
tmr00281  Geraniol degradation
tmr00310  Lysine degradation
tmr00360  Phenylalanine metabolism
tmr00362  Benzoate degradation
tmr00380  Tryptophan metabolism
tmr00410  beta-Alanine metabolism
tmr00627  Aminobenzoate degradation
tmr00640  Propanoate metabolism
tmr00650  Butanoate metabolism
tmr00903  Limonene and pinene degradation
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tmar_1085
   00650 Butanoate metabolism
    Tmar_1085
  Lipid metabolism
   00071 Fatty acid degradation
    Tmar_1085
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tmar_1085
   00310 Lysine degradation
    Tmar_1085
   00360 Phenylalanine metabolism
    Tmar_1085
   00380 Tryptophan metabolism
    Tmar_1085
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tmar_1085
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tmar_1085
   00281 Geraniol degradation
    Tmar_1085
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmar_1085
   00627 Aminobenzoate degradation
    Tmar_1085
   00930 Caprolactam degradation
    Tmar_1085
Enzymes [BR:tmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tmar_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU51198
JGI: Tmar_1085
UniProt: E6SK57
Position
complement(1313747..1314556)
Genome map
AA seq 269 aa AA seqDB search
MASWWPQYRRLQLGWAEPGILEVVLERPETLNSIDAETHTELARIWRDLDADAQVRVVLV
RGAGKAFSAGGDFRLVEAIIQDPQVRVRVWKEARDLVYNLIHCSKPVVSAIEGPAVGAGL
AVALLADISVAARGARLLDGHVRLGVAAGDHAAIVWPLLVGMAKAKYHLLLNEPVTGEQA
ERMGLVSLCVDDGQARETALAIARRLAAGSPTAIRWTKYALNNWLRAAGPIFDTSTALEF
LGFTLPDAAEGLASLRAKRAPRFQPESPL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgtggtggccgcagtaccgccggttgcagctcgggtgggccgagcccggcatc
ctcgaggtggtcctggaacggccggaaactttgaactccatcgacgccgagacccacacc
gaactggcccggatctggcgggacctggacgccgatgcccaggtgcgggtggtcctggtg
cggggcgccgggaaggccttttccgccggcggcgacttccggctggtggaagcgatcatc
caggacccgcaggtccgggtgcgggtgtggaaggaagcccgcgacctggtctacaacctg
atccactgctccaagcccgtggtctccgccatcgaagggccggcggtgggggccggtctc
gccgtggccctgctggccgacatctccgtggcggcccgcggcgcccggctgctggacggc
cacgtccgcctgggcgtggcggcaggcgatcacgccgccatcgtttggccgctgctggtc
ggcatggccaaggccaagtaccacctgcttctcaacgagcccgtgacgggagagcaggcg
gagaggatggggctggtgtccctctgcgtcgacgacggccaggcgcgggagacggccctg
gccatcgcccggcgcctggccgcaggcagcccgacggccatccgctggaccaagtacgcc
ctcaacaactggctcagggcggccggcccgatcttcgacacttcgacggccctggagttc
ctgggctttaccctgccggacgccgccgagggcctggcatcgctgcgggccaagcgggcg
ccgcggttccagccggagtcgccgctctag

DBGET integrated database retrieval system