KEGG   Thermaerobacter marianensis: Tmar_1246Help
Entry
Tmar_1246         CDS       T01388                                 

Definition
ATPase AAA
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tmar_1246
Enzymes [BR:tmr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tmar_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1490137..1492497)
Genome map
AA seq 786 aa AA seqDB search
MQDYTALIRHEGNRQLFEAVEMSIIAQLWGEPLHLHAEGVRGTGKTTILRAARRILPRIE
RIRGCPYNCDPRGPHCPLHAHWTPAQIAAHGTEWIPMPFREISPSAKVGTVTGSLDLARL
TDVGRPEAALLPGTLAQAHRGIVLVDEINRVADVAPELADCLLDVMGTKPGRLQIEETGL
PPVELTVRVAVWAASNPDEEPGPLEEIRRQLSDRFDLVLDVRRPGEPWLVKRILALGEAR
ARAAAEAAQAALAGWAALRGRDGAVQGGPGGPAGAVQDAPAIQQGPAHGGPAGQRAPADE
SGPRTGTGEEPARAEGGAGTGAPGAPVAEAGGRGRAAAAGLAPSTAPAVEEGPALGPGPG
AAKDREAADGGAPQRESGEGVGAAGGNPDAAWDAVAAGMRVRLPEPVAEQGTGSEGSSSA
AGNGQVAAPARPPAAGVGADGGAPVAAGSPAPAGPGTPAGTAEAFRTLATPRPGEDPWSR
RWREAAGRRPEFPEPLLDVLAEIYVQFRLESLRALEAWRNAAALYAARAGRRQVRREDLL
EVAPAVLRHRVEAGVLSEILEFLARDEATRAEDQRGRDLNGSGGRDGTAPWDAGRGTVWP
AVPGGGGMAGAAGGPGDGPADVPGGQAPGLPGELPRQRGAGADAAARAATADTGAGGVWS
RLREMLARAAGPADPGGTRGGASPAAGGAPASGRGAGLHDRAGLHAGAATPAGGGAGVAP
GGSLAALGAGGAGGPGATGPGACHPGSAAGAGPVRPGAREGTTPPHRARPLLELTRDRAI
RSWFHP
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattacacggccctgattcggcacgagggcaaccgccagctcttcgaagccgtg
gagatgtccatcatcgcccagctctggggcgagccgctccacctgcacgccgaaggggtg
cggggtaccggcaagaccaccatcctgcgggcggcgcggcgcatcctgccgcgcatcgag
cggatccgcggctgcccctacaactgcgacccgcgggggccccactgccccctgcacgcc
cactggacccccgcccagatcgccgcccacggcaccgagtggatccccatgcccttccgc
gagatctcgccatcggccaaagtgggtacggtcaccggcagcctggacctggcccgcttg
accgacgtcgggcggccggaggcggccctgctgcccgggaccctggcccaagcccaccgg
gggatcgtgctggtcgatgagatcaaccgggtggccgatgtggcccccgaactggccgac
tgcctgctggacgtcatgggcaccaagcccggacgcttgcagatcgaggagacggggctg
ccccccgtggaattgacggtccgggtggccgtatgggctgcctccaaccccgatgaagaa
cccggtcccctggaggagatccgccggcagctgtccgaccggttcgacctggtgctggac
gtgcgccgtccgggcgagccgtggctggtcaagcgcatcctggcgctgggcgaggcgcgg
gcgcgggcggcggcggaggcggcgcaggcggcgctggcggggtgggcggccctgagggga
cgggacggcgcggtccaggggggaccgggcggtccggccggagcggtgcaagatgctccg
gcgatccagcaggggccggcccacggggggccggccggacagcgggcaccggcggacgaa
agcggcccccggacggggaccggcgaggaacccgcccgggcggaaggcggggccggaacg
ggggccccgggggccccggtcgccgaagccggcggccggggacgggctgcggccgccggg
cttgccccctccaccgccccggcggttgaggaaggcccggccctcgggcccgggcctggt
gcggcgaaggaccgggaggcggccgatggcggcgccccacagagggaatcgggcgaaggc
gtcggggccgcgggcggaaacccggacgcagcgtgggatgcggttgcggccgggatgcgc
gtccgcctgcccgagcccgtggcagagcagggcacgggcagcgaaggcagctcgtcggcg
gcgggcaacggccaggtcgcggcgccagcgcgaccgccggcggccggcgtgggggcggac
ggcggcgcgccggtggccgccggttcgccggcgccggcggggccgggcacgcctgcgggg
acggccgaagccttccggacgctggcaaccccgcgacccggcgaggacccgtggagccgc
cgctggcgggaagcggccggccggcggcccgagtttcccgaaccgctgctggatgtcctg
gcggagatctacgtgcagttccggctggagagcctgcgcgccctggaggcgtggcgcaac
gccgcggcgctgtacgccgcccgggcaggccggcgccaggtgcggcgggaggaccttctg
gaggtggcccccgccgtcctccgtcaccgggtggaggcgggggtgctgagcgagatcctg
gagttcctggcccgggacgaggccacccgggccgaggaccagcgggggcgggacctgaac
gggtcggggggccgtgacgggaccgccccttgggatgccggccgcgggacggtctggccg
gcggtgccggggggcgggggcatggccggggccgccggcggcccgggtgacggcccggcg
gacgttcccggcggccaggcgccgggcctgccgggggagcttccccggcaacgtggggcc
ggggccgacgccgcggcgcgggcggctaccgccgacacgggcgcgggcggcgtgtggagc
cgcctgcgggagatgctggcccgcgccgcgggtcccgccgatcccggcgggacccgcggg
ggcgcctcccccgcggccggaggcgcccccgcctccggccgcggggcgggcctgcacgac
cgcgcgggcctgcacgccggcgccgccacccctgccggtggcggcgccggcgtggccccg
ggcggcagcctggcggccctcggggccggtggcgccggcggccccggcgccaccggcccc
ggggcctgccacccgggctccgccgcgggcgccgggcctgtccggcccggcgcccgggag
ggcaccaccccgccccaccgggcccggccgctgctggagctcacccgggaccgggccatc
cggtcgtggttccacccgtga

DBGET integrated database retrieval system