KEGG   Thermaerobacter marianensis: Tmar_1260Help
Entry
Tmar_1260         CDS       T01388                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tmr  Thermaerobacter marianensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tmr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1508075..1509487)
Genome map
AA seq 470 aa AA seqDB search
MPARGAGRGRPAEDPGRDRPVPAPAGWAGGRAGHGTGSTGNGAPDGGGGAGGPEASGGDA
WGLPGSVYVIEAGPGDPGLLTVRASRLLQAAEVVVADPGLDAVLRAWLSPTAALWLLGGR
PSGSRSAADLLPVAGRLEPGRVAPRLARWARSGLRAVRLVRGPVPPEEVAALAAAGVAVV
PVPGVPAAPPPVAPGSGAVPPLAGWRIAITRAAEQAGDLAELVRRLGGEAVEIPLIAVEP
AEGVAGLDAELADPQGTWWAFTSRNAVAALAGRLRALGRDARALAGSRVAAVGEATGRAL
EEAVGIRADLVPATATGGHLWEELARRVQPGQRVLWPRGDRAPLEPARPVVEAGAVLRAP
VVYRTVLRPREAAALLELVAAGRVDAVTLASPSACEALAEAAGPEGLGRFFPGGGPAGPG
GRRPLVVCIGPRTARRAAALGLPVDRVPERYTVEGLIGALLEANRAGGGA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcaaggggtgccgggcgagggcggccggcggaggatcccggccgggaccggccg
gtgcccgcccctgcagggtgggctggcgggagggcgggccatggaaccggcagcacgggg
aacggcgcccccgacgggggtggcggcgccggcgggccggaggcgtccggcggggacgcc
tggggcttgccggggtcggtgtacgtgatcgaagccggccccggcgatcccgggctgctc
accgtgcgggcgagccggctgttgcaggcggcggaggtggtcgtcgccgatcccggcctg
gacgccgtgctccgggcctggctgtcccccacggccgccttgtggctcctcggcggccgg
ccaagcggttcccggtccgccgccgacctgctgcccgtggccggccggctggagcccggc
cgggtggcgccgcggctggctcgctgggcgcggtcgggcttgcgggcggtgcgcctggtc
cgggggccggtcccgccggaggaggtggccgctctggcggcggccggggtggcggtggtc
cccgtgcccggcgtgccggcggcgccccctcccgtcgccccggggtccggggcggtgccg
cccctggccgggtggcgcatcgccatcacccgggccgctgagcaggccggcgacctggcc
gagctggtccgccggctgggcggcgaggcggtggagatccccctgatcgccgtggaaccg
gcggagggggtggccggcctggatgcggaactggccgacccccaagggacgtggtgggcc
ttcaccagccgcaacgccgtggcggccctggcgggccgcttgcgggccctgggccgggac
gcccgcgccctggccgggtcccgggtcgcggcggtgggggaggccaccgggcgggcactg
gaggaggccgtggggatccgggccgacctggtgcccgccaccgccaccggcggccatctc
tgggaggagctggcccgccgcgtgcaaccgggccagcgggtcctctggccccggggcgac
cgggctccgctcgagcccgcacggcccgtcgtggaggccggggcggtgctgcgggccccc
gtggtctaccggaccgtcctgcgtccccgggaggcagcggccctgctcgagctggtggcg
gcgggccgggtcgacgccgtcaccctggccagcccgtcggcgtgcgaggcgctggccgag
gcggccggcccggaagggctcggccggttcttcccgggcggtggaccggcgggtcccggc
ggcaggcggcccctggtggtgtgcatcggaccgcgcaccgcccggcgggcggcggccctg
ggcctgcccgtcgaccgcgttcccgagcggtacacggtggaaggactgatcggcgccctt
ctcgaagccaacagggctggcgggggcgcctga

DBGET integrated database retrieval system