KEGG   Thermaerobacter marianensis: Tmar_1260Help
Entry
Tmar_1260         CDS       T01388                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00860  Porphyrin and chlorophyll metabolism
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
Module
tmr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tmar_1260
Enzymes [BR:tmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Tmar_1260
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tmar_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ADU51373
JGI: Tmar_1260
UniProt: E6SLS4
Position
complement(1508075..1509487)
Genome map
AA seq 470 aa AA seqDB search
MPARGAGRGRPAEDPGRDRPVPAPAGWAGGRAGHGTGSTGNGAPDGGGGAGGPEASGGDA
WGLPGSVYVIEAGPGDPGLLTVRASRLLQAAEVVVADPGLDAVLRAWLSPTAALWLLGGR
PSGSRSAADLLPVAGRLEPGRVAPRLARWARSGLRAVRLVRGPVPPEEVAALAAAGVAVV
PVPGVPAAPPPVAPGSGAVPPLAGWRIAITRAAEQAGDLAELVRRLGGEAVEIPLIAVEP
AEGVAGLDAELADPQGTWWAFTSRNAVAALAGRLRALGRDARALAGSRVAAVGEATGRAL
EEAVGIRADLVPATATGGHLWEELARRVQPGQRVLWPRGDRAPLEPARPVVEAGAVLRAP
VVYRTVLRPREAAALLELVAAGRVDAVTLASPSACEALAEAAGPEGLGRFFPGGGPAGPG
GRRPLVVCIGPRTARRAAALGLPVDRVPERYTVEGLIGALLEANRAGGGA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcaaggggtgccgggcgagggcggccggcggaggatcccggccgggaccggccg
gtgcccgcccctgcagggtgggctggcgggagggcgggccatggaaccggcagcacgggg
aacggcgcccccgacgggggtggcggcgccggcgggccggaggcgtccggcggggacgcc
tggggcttgccggggtcggtgtacgtgatcgaagccggccccggcgatcccgggctgctc
accgtgcgggcgagccggctgttgcaggcggcggaggtggtcgtcgccgatcccggcctg
gacgccgtgctccgggcctggctgtcccccacggccgccttgtggctcctcggcggccgg
ccaagcggttcccggtccgccgccgacctgctgcccgtggccggccggctggagcccggc
cgggtggcgccgcggctggctcgctgggcgcggtcgggcttgcgggcggtgcgcctggtc
cgggggccggtcccgccggaggaggtggccgctctggcggcggccggggtggcggtggtc
cccgtgcccggcgtgccggcggcgccccctcccgtcgccccggggtccggggcggtgccg
cccctggccgggtggcgcatcgccatcacccgggccgctgagcaggccggcgacctggcc
gagctggtccgccggctgggcggcgaggcggtggagatccccctgatcgccgtggaaccg
gcggagggggtggccggcctggatgcggaactggccgacccccaagggacgtggtgggcc
ttcaccagccgcaacgccgtggcggccctggcgggccgcttgcgggccctgggccgggac
gcccgcgccctggccgggtcccgggtcgcggcggtgggggaggccaccgggcgggcactg
gaggaggccgtggggatccgggccgacctggtgcccgccaccgccaccggcggccatctc
tgggaggagctggcccgccgcgtgcaaccgggccagcgggtcctctggccccggggcgac
cgggctccgctcgagcccgcacggcccgtcgtggaggccggggcggtgctgcgggccccc
gtggtctaccggaccgtcctgcgtccccgggaggcagcggccctgctcgagctggtggcg
gcgggccgggtcgacgccgtcaccctggccagcccgtcggcgtgcgaggcgctggccgag
gcggccggcccggaagggctcggccggttcttcccgggcggtggaccggcgggtcccggc
ggcaggcggcccctggtggtgtgcatcggaccgcgcaccgcccggcgggcggcggccctg
ggcctgcccgtcgaccgcgttcccgagcggtacacggtggaaggactgatcggcgccctt
ctcgaagccaacagggctggcgggggcgcctga

DBGET integrated database retrieval system