KEGG   Thermaerobacter marianensis: Tmar_1266Help
Entry
Tmar_1266         CDS       T01388                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tmr  Thermaerobacter marianensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_1266
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tmar_1266
   00640 Propanoate metabolism
    Tmar_1266
   00660 C5-Branched dibasic acid metabolism
    Tmar_1266
Enzymes [BR:tmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tmar_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1515078..1516199)
Genome map
AA seq 373 aa AA seqDB search
MKFFEYMAKEVFRERGIPTPRGRVAASPGEAAQVAAEIGAPVAIKSQVLAGGRGKAGGIR
FADTPDQAREVAAGLLGQEVRGYRVERVLVEEKLQIDRELYLGIAVDTARKSPLVIASVH
GGVNIEEVPEKDIVKRPVDITLGLYPYFARGIARRLGLEGAIARQFADILTRLYRIFRDY
DAELVEINPLVISGDRLIAADGRLNIDDDARFRHQDLPEVSEATELERRVREIGLSYVEL
DGDIAVMANGAGITMATIDVLAEYGGRAMNFLDAGGGAAVEPMAKAMAVLVSTNPKAIFV
NIFGGITRCDDVANAIVTVKQQQGIPVPLVVRLVGTNEDKGVAILREHGIEAFRDMGEAA
RKAVELARQGGER
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttcttcgagtacatggccaaggaggtcttccgagaacggggcatccctacgccg
cggggtcgggtggcagcctcccccggcgaagcggcccaggtggccgccgagatcggcgcg
ccggtggcgatcaagtcccaggtcctggccggtggccgcggcaaggccggcggcattcgg
tttgccgacacccccgaccaggcccgggaggtggccgcaggtcttttggggcaggaggtc
cggggctaccgggtcgagcgggtgctggtggaggagaagctgcagatcgaccgggagctc
tacctgggcatcgccgtggacacggcgcgcaagtcgccgctggtcatcgcctcggtgcac
ggcggcgtgaacatcgaggaagtcccggagaaggacatcgtcaagcggccggtggacatc
accctgggcctctacccgtatttcgcccggggcatcgcccggcgactgggcctggagggg
gccatcgcccgccagttcgccgacatcctgacgcggctgtaccggatcttccgcgactac
gacgccgagctcgtggagatcaacccgctggtgatctccggtgaccggctgatcgctgcc
gacggacgcctcaacatcgacgacgacgcccgcttccgccaccaggacctgcccgaggtc
agcgaggccacggaactggagcgccgcgtccgggagatcggcctctcgtacgtggagctg
gacggtgacatcgccgtcatggccaacggcgcgggcatcaccatggccaccatcgacgtg
ctggccgagtacggcggccgggcgatgaacttcctcgatgccggcggcggcgcggcggtg
gagcccatggcgaaggccatggcggtgctggtgtcgacgaaccccaaggcgatcttcgtc
aacatcttcggcggcatcacccgctgcgacgacgtggccaacgccatcgtcaccgtcaag
cagcagcagggcatcccggtgccgctggtggtgcggctggtgggcaccaacgaggacaag
ggcgtggcaatcctcagggagcacggcatcgaagccttccgggacatgggcgaggccgcc
cgcaaggcggtggagctggcccggcagggaggggagcggtag

DBGET integrated database retrieval system