KEGG   Thermaerobacter marianensis: Tmar_1394Help
Entry
Tmar_1394         CDS       T01388                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tmr  Thermaerobacter marianensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tmar_1394
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tmar_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1665560..1666150)
Genome map
AA seq 196 aa AA seqDB search
MPRRAEEFDLERIQRAVLDILEAVGEDPTREGLVDTPRRVAEAYQELFSGLGRDPADELS
VFFSTDHDEVVLVKDIPFYSICEHHLLPFHGRAHVAYLPRNGRITGLSKLARAVEVASRR
PQLQERLTVQIADAIEQRLNPRGVVVVIEAEHLCMTMRGIQKPGSYAVTSAVRGLFRENV
ASRHEVFALIRSDLRP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgacgcgccgaagagttcgacctggaaaggatccagcgagcggttctcgacatc
ctggaggccgtgggggaagacccgacccgtgaagggctggtggacacgccccgccgcgtg
gcggaggcgtaccaggagctcttcagcggcctcggccgcgaccccgccgacgagctcagc
gtgttcttctcgacggaccacgacgaggtggtcctggtcaaggacatcccgttctattcc
atctgcgagcaccacctgctgcccttccacggccgcgcccacgtggcctacctgccgcgc
aacggccgcatcaccggcctgagcaagctggcccgggcggtggaggtcgcctcgcgccgg
ccccagctgcaagagcggctcaccgtccagatcgccgacgccatcgaacagcgcctcaac
ccgcggggcgtggtggtggtcatcgaggcggagcacctctgcatgacgatgcggggcatc
cagaagcccggctcctacgccgtcacctcggcggtccgcggcctcttccgggagaacgtg
gccagccgccacgaggtcttcgccctgatccgcagcgacctgcggccctga

DBGET integrated database retrieval system