KEGG   Thermaerobacter marianensis: Tmar_1450Help
Entry
Tmar_1450         CDS       T01388                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00260  Glycine, serine and threonine metabolism
tmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01130  Biosynthesis of antibiotics
tmr01230  Biosynthesis of amino acids
Module
tmr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmar_1450
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmar_1450
Enzymes [BR:tmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmar_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADU51563
JGI: Tmar_1450
UniProt: E6SMS1
Position
complement(1736569..1737627)
Genome map
AA seq 352 aa AA seqDB search
MNRVNRSTAGAAEGEAGGSQPRPGAAASRPGAMALGAGVPASPTAVPAFANGAEAAPAGA
VAPGGTVPEPVNRLDDALARARAEGRAALIVYVTAGHPGLEATRQLVPALFAAGADVVEL
GMPFSDPLADGPTIQRSTQHALARGVRLGDVLDLVRDLRAGGVDGALVLLTYANPLLARG
LLDEPAPLAAAGFDGVIIPDLPLVERGAADAAFRAAGLHLIPMVAPTSSPEHVRQATAGR
GGFVYCVSVTGVTGARKDLPEELPAWLDRVRAAGPRPVAIGFGVAGPEQARALAAHADAV
IVGSALVDRIEAAAGGAADPVGKEEEYRIRAVVDAATSFVAALRQAVAEAPS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgtgaaccggtccacggccggagcggcggagggcgaagccggcggatcccag
ccccgacccggggcagcggcgtcgcgcccgggggcgatggcgctgggggccggcgtcccg
gcgtctcccaccgcggtcccggcatttgccaacggcgccgaggccgcgccggccggggcg
gtggcgcccggcggcacggtgccggagccggtcaaccgcctggatgacgctctggcccgg
gcccgggccgaagggcgggcggcactgatcgtgtacgtcaccgcggggcatcccggcctg
gaggccacccgccagctggtccccgccctctttgcggccggcgccgacgtggtcgagctg
gggatgcccttctccgatccgttggccgacgggccgaccatccagcggtcgacccagcac
gccctggcgcggggggtgcggcttggggacgtgctggacctggtgcgggacctgcgtgcc
ggcggcgtggacggggcgctggtgctgctgacctacgccaaccccctgctggcccgcggc
ctgctggacgaaccggcccccctggccgccgcaggctttgacggggtgatcatccccgac
ctgccgctggtggaacggggggcggcggacgcggcgttccgggcggccggcttgcacctg
atccccatggtggcccccaccagctcgcccgaacacgtgcgccaggccaccgccggccgg
ggcgggttcgtctactgcgtctcggtgacgggggtgacgggggcgcggaaggacctgccc
gaggagctgccggcgtggctcgaccgggtccgcgcggcggggccgcggcccgtggccatc
gggttcggcgtcgccggccccgagcaggcgcgggccctggccgcccacgccgacgcggtc
atcgtggggtcggcgctggtcgaccgcatcgaggcggcggcgggaggagccgccgacccg
gtcgggaaggaagaagagtaccgtatccgtgccgtggtggacgcggcgacctcgttcgtc
gcggcgctccggcaggccgtcgcggaggccccatcctga

DBGET integrated database retrieval system