KEGG   Thermaerobacter marianensis: Tmar_1450Help
Entry
Tmar_1450         CDS       T01388                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmar_1450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmar_1450
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmar_1450
Enzymes [BR:tmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmar_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1736569..1737627)
Genome map
AA seq 352 aa AA seqDB search
MNRVNRSTAGAAEGEAGGSQPRPGAAASRPGAMALGAGVPASPTAVPAFANGAEAAPAGA
VAPGGTVPEPVNRLDDALARARAEGRAALIVYVTAGHPGLEATRQLVPALFAAGADVVEL
GMPFSDPLADGPTIQRSTQHALARGVRLGDVLDLVRDLRAGGVDGALVLLTYANPLLARG
LLDEPAPLAAAGFDGVIIPDLPLVERGAADAAFRAAGLHLIPMVAPTSSPEHVRQATAGR
GGFVYCVSVTGVTGARKDLPEELPAWLDRVRAAGPRPVAIGFGVAGPEQARALAAHADAV
IVGSALVDRIEAAAGGAADPVGKEEEYRIRAVVDAATSFVAALRQAVAEAPS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgtgaaccggtccacggccggagcggcggagggcgaagccggcggatcccag
ccccgacccggggcagcggcgtcgcgcccgggggcgatggcgctgggggccggcgtcccg
gcgtctcccaccgcggtcccggcatttgccaacggcgccgaggccgcgccggccggggcg
gtggcgcccggcggcacggtgccggagccggtcaaccgcctggatgacgctctggcccgg
gcccgggccgaagggcgggcggcactgatcgtgtacgtcaccgcggggcatcccggcctg
gaggccacccgccagctggtccccgccctctttgcggccggcgccgacgtggtcgagctg
gggatgcccttctccgatccgttggccgacgggccgaccatccagcggtcgacccagcac
gccctggcgcggggggtgcggcttggggacgtgctggacctggtgcgggacctgcgtgcc
ggcggcgtggacggggcgctggtgctgctgacctacgccaaccccctgctggcccgcggc
ctgctggacgaaccggcccccctggccgccgcaggctttgacggggtgatcatccccgac
ctgccgctggtggaacggggggcggcggacgcggcgttccgggcggccggcttgcacctg
atccccatggtggcccccaccagctcgcccgaacacgtgcgccaggccaccgccggccgg
ggcgggttcgtctactgcgtctcggtgacgggggtgacgggggcgcggaaggacctgccc
gaggagctgccggcgtggctcgaccgggtccgcgcggcggggccgcggcccgtggccatc
gggttcggcgtcgccggccccgagcaggcgcgggccctggccgcccacgccgacgcggtc
atcgtggggtcggcgctggtcgaccgcatcgaggcggcggcgggaggagccgccgacccg
gtcgggaaggaagaagagtaccgtatccgtgccgtggtggacgcggcgacctcgttcgtc
gcggcgctccggcaggccgtcgcggaggccccatcctga

DBGET integrated database retrieval system